Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03313
Gene name
Locationscaffold_03:2329580..2331811
Strand+
Gene length (bp)2231
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02582 DUF155 RMND1/Sif2-Sif3/Mrx10, DUF155 2.6E-52 336 518

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 542 564 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 71.88 40.79 102.98
Alive In ants, during behavior modification 89.26 49.32 129.19
Dead In ants, recently dead 87.48 48.75 126.21

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.274952 no
Alive Dead 0.926470 no
Dead Fungus 0.335386 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03313
MKPGTKFANRLCSIPPLDPRAMSSGKQRPSVLVTDSRQRATRTRRQDTSLASSGRTPMRFMTVDNVLQYNSQIPS
GQPRGPPAPVQRLLPAAAGMAPGRRVAAVGLPNGQSRTGQSMPSRTTKISEKLVLLPEADPGEEDEAEGEAESEN
LARRLQEEYNRPLKDEELDVLRKRGGIRGKSFAERLPKVQRKDKVSRLTAYCTAQAFKVGATSEFLRKKHEAKTK
LYDDCLYVIYALPLLNGTDGYRVRGRPMLKTPGTGKTMLDLEIERSERRDHYEGYFEDDAYTNPESPDRGSRATP
PFGDPSPDDDMHREHDDGFRSHINRIAPDAKSFAEMFVFSYGVVVFWNFTEHQEKDILADLTFADAQDGISLLTR
PFEQDTFETEEFHFEYSADVKRPRVFNDMITLMPRSDHMIKLTISHSIAQSTKLCFFEERMSETMLDAQHVPKRL
ALTGHLNMTRTEIVKILGRLFKSRVDINLSSNILDVPNFFWDSEPTLHPLYVAVREYLEIDPRIKVLNERCRVFL
DLAEILSDSVNDAKMSYITWIIIILIVVSILVTVTEVGLRFGMLSKSSNKAKGLAGVTAISWAGGRSPGAVPEMI
LVPPPAAADVDEIGKLALVLGLQSNASFDDVQQGIIDLRRAAARRRR*
Coding >Ophcf2|03313
ATGAAGCCCGGCACTAAATTCGCCAACCGTCTTTGTTCGATTCCTCCGCTTGACCCTCGTGCCATGTCTTCGGGA
AAACAGCGACCATCTGTACTGGTTACGGACTCGAGGCAAAGGGCTACGAGAACGCGACGTCAGGACACTTCATTG
GCGTCCAGCGGCCGGACGCCGATGCGATTTATGACGGTCGATAACGTCCTTCAGTACAACTCGCAGATCCCCTCC
GGTCAACCACGGGGTCCTCCCGCTCCCGTTCAGCGATTACTTCCTGCAGCCGCCGGCATGGCTCCCGGACGTCGA
GTCGCTGCCGTCGGGCTACCCAACGGCCAATCACGCACAGGGCAGTCGATGCCATCGAGGACGACTAAGATCAGC
GAGAAGCTGGTCCTTCTCCCGGAGGCGGATCCAGGCGAAGAGGACGAGGCCGAGGGTGAGGCCGAGAGCGAGAAC
TTGGCCAGAAGACTGCAGGAGGAGTATAACCGGCCGCTCAAAGACGAGGAGCTGGATGTGTTGAGGAAGAGAGGT
GGCATCCGCGGCAAAAGCTTTGCAGAGCGGCTTCCTAAAGTACAGAGGAAAGACAAGGTTAGCCGTCTGACGGCC
TACTGCACGGCTCAGGCGTTCAAGGTCGGCGCCACATCCGAGTTCCTGAGGAAGAAGCACGAGGCGAAAACGAAA
CTCTACGACGACTGTCTCTACGTCATATACGCCCTACCCTTGCTCAACGGAACCGATGGCTACCGGGTCCGCGGC
CGGCCCATGCTCAAGACTCCGGGGACAGGCAAAACCATGCTTGATCTGGAGATTGAGCGAAGCGAGCGTCGAGAC
CATTACGAAGGATACTTTGAGGATGACGCATACACAAATCCTGAGAGTCCGGACAGAGGCAGTCGCGCGACGCCG
CCCTTTGGCGACCCGTCTCCCGACGACGATATGCACAGGGAGCACGACGACGGGTTCCGATCGCACATCAATCGC
ATCGCGCCCGACGCTAAGAGCTTCGCCGAGATGTTTGTCTTCTCCTACGGCGTAGTCGTCTTCTGGAACTTCACA
GAGCATCAGGAAAAGGACATCCTCGCGGATCTGACATTCGCCGACGCCCAAGACGGCATCAGCCTCCTGACCAGG
CCATTCGAGCAAGACACGTTCGAGACGGAAGAGTTTCACTTCGAGTACAGCGCCGACGTCAAGCGGCCGCGAGTG
TTTAACGACATGATTACGCTGATGCCGCGGTCGGACCACATGATCAAGCTGACCATCAGCCACTCGATCGCGCAG
AGCACCAAGCTGTGTTTCTTTGAGGAGCGGATGAGCGAGACGATGCTTGATGCGCAGCACGTGCCCAAGAGGCTG
GCCTTGACCGGGCATCTCAACATGACGAGAACGGAGATTGTCAAGATACTCGGCAGGCTGTTTAAGAGCCGCGTC
GACATCAATCTGTCATCCAATATTCTCGACGTGCCCAACTTCTTCTGGGACTCGGAACCGACACTGCATCCGCTT
TACGTGGCGGTGCGCGAATACCTCGAGATCGACCCTCGTATCAAGGTGCTCAACGAGCGATGCCGCGTCTTCCTC
GACCTGGCCGAGATCCTGTCGGACTCGGTCAACGACGCCAAGATGAGTTACATTACGTGGATCATCATCATCCTC
ATCGTCGTCAGCATCCTCGTCACCGTCACCGAAGTCGGGCTGCGGTTCGGCATGCTTAGCAAGAGTTCGAACAAG
GCCAAGGGCTTGGCGGGCGTGACAGCCATCAGTTGGGCTGGGGGTCGCAGCCCGGGCGCGGTGCCCGAGATGATA
CTCGTTCCCCCGCCGGCGGCGGCGGACGTGGACGAAATAGGGAAGCTCGCTCTAGTGCTCGGCCTGCAGTCCAAC
GCCAGCTTCGACGACGTGCAACAAGGTATCATCGACTTGAGGCGGGCGGCGGCGCGTCGGCGTCGTTAA
Transcript >Ophcf2|03313
ATGAAGCCCGGCACTAAATTCGCCAACCGTCTTTGTTCGATTCCTCCGCTTGACCCTCGTGCCATGTCTTCGGGA
AAACAGCGACCATCTGTACTGGTTACGGACTCGAGGCAAAGGGCTACGAGAACGCGACGTCAGGACACTTCATTG
GCGTCCAGCGGCCGGACGCCGATGCGATTTATGACGGTCGATAACGTCCTTCAGTACAACTCGCAGATCCCCTCC
GGTCAACCACGGGGTCCTCCCGCTCCCGTTCAGCGATTACTTCCTGCAGCCGCCGGCATGGCTCCCGGACGTCGA
GTCGCTGCCGTCGGGCTACCCAACGGCCAATCACGCACAGGGCAGTCGATGCCATCGAGGACGACTAAGATCAGC
GAGAAGCTGGTCCTTCTCCCGGAGGCGGATCCAGGCGAAGAGGACGAGGCCGAGGGTGAGGCCGAGAGCGAGAAC
TTGGCCAGAAGACTGCAGGAGGAGTATAACCGGCCGCTCAAAGACGAGGAGCTGGATGTGTTGAGGAAGAGAGGT
GGCATCCGCGGCAAAAGCTTTGCAGAGCGGCTTCCTAAAGTACAGAGGAAAGACAAGGTTAGCCGTCTGACGGCC
TACTGCACGGCTCAGGCGTTCAAGGTCGGCGCCACATCCGAGTTCCTGAGGAAGAAGCACGAGGCGAAAACGAAA
CTCTACGACGACTGTCTCTACGTCATATACGCCCTACCCTTGCTCAACGGAACCGATGGCTACCGGGTCCGCGGC
CGGCCCATGCTCAAGACTCCGGGGACAGGCAAAACCATGCTTGATCTGGAGATTGAGCGAAGCGAGCGTCGAGAC
CATTACGAAGGATACTTTGAGGATGACGCATACACAAATCCTGAGAGTCCGGACAGAGGCAGTCGCGCGACGCCG
CCCTTTGGCGACCCGTCTCCCGACGACGATATGCACAGGGAGCACGACGACGGGTTCCGATCGCACATCAATCGC
ATCGCGCCCGACGCTAAGAGCTTCGCCGAGATGTTTGTCTTCTCCTACGGCGTAGTCGTCTTCTGGAACTTCACA
GAGCATCAGGAAAAGGACATCCTCGCGGATCTGACATTCGCCGACGCCCAAGACGGCATCAGCCTCCTGACCAGG
CCATTCGAGCAAGACACGTTCGAGACGGAAGAGTTTCACTTCGAGTACAGCGCCGACGTCAAGCGGCCGCGAGTG
TTTAACGACATGATTACGCTGATGCCGCGGTCGGACCACATGATCAAGCTGACCATCAGCCACTCGATCGCGCAG
AGCACCAAGCTGTGTTTCTTTGAGGAGCGGATGAGCGAGACGATGCTTGATGCGCAGCACGTGCCCAAGAGGCTG
GCCTTGACCGGGCATCTCAACATGACGAGAACGGAGATTGTCAAGATACTCGGCAGGCTGTTTAAGAGCCGCGTC
GACATCAATCTGTCATCCAATATTCTCGACGTGCCCAACTTCTTCTGGGACTCGGAACCGACACTGCATCCGCTT
TACGTGGCGGTGCGCGAATACCTCGAGATCGACCCTCGTATCAAGGTGCTCAACGAGCGATGCCGCGTCTTCCTC
GACCTGGCCGAGATCCTGTCGGACTCGGTCAACGACGCCAAGATGAGTTACATTACGTGGATCATCATCATCCTC
ATCGTCGTCAGCATCCTCGTCACCGTCACCGAAGTCGGGCTGCGGTTCGGCATGCTTAGCAAGAGTTCGAACAAG
GCCAAGGGCTTGGCGGGCGTGACAGCCATCAGTTGGGCTGGGGGTCGCAGCCCGGGCGCGGTGCCCGAGATGATA
CTCGTTCCCCCGCCGGCGGCGGCGGACGTGGACGAAATAGGGAAGCTCGCTCTAGTGCTCGGCCTGCAGTCCAAC
GCCAGCTTCGACGACGTGCAACAAGGTATCATCGACTTGAGGCGGGCGGCGGCGCGTCGGCGTCGTTAA
Gene >Ophcf2|03313
ATGAAGCCGTCACCAGCGGACTCCGGTGTGCCTCTGACAGGCCACCAACGGTCGCGGCTAAAACCCTCAGCAACC
TTATGATGTCGGTCGAGCGGCACTAAATTCGCCAACCGTCTTTGTTCGATTCCTCCGCTTGACGTGAGTCACGTG
ATATACCTCCCCAAACGTCCCAACAAGGACGCCCCGCTTTGCCGATGTGCCTTGTTAATCATCAACCTCTTCGAC
CAACCTCGCAGCCTCGTGCCATGTCTTCGGGAAAACAGCGACCATCTGTACTGGTGCGGCTCCATTCTATGCTCA
CCGTCCGTTTCTGGGCTAACTTATGCAGGTTACGGACTCGAGGCAAAGGGCTACGAGAACGCGACGTCAGGACAC
TTCATTGGCGTCCAGCGGCCGGACGCCGATGCGATTTATGACGGTCGATAACGTCCTTCAGTACAACTCGCAGAT
CCCCTCCGGTCAACCACGGGGTCCTCCCGCTCCCGTTCAGCGATTACTTCCTGCAGCCGCCGGCATGGCTCCCGG
ACGTCGAGTCGCTGCCGTCGGGCTACCCAACGGCCAATCACGCACAGGGCAGTCGATGCCATCGAGGACGACTAA
GATCAGCGAGAAGCTGGTCCTTCTCCCGGAGGCGGATCCAGGCGAAGAGGACGAGGCCGAGGGTGAGGCCGAGAG
CGAGAACTTGGCCAGAAGACTGCAGGAGGAGTATAACCGGCCGCTCAAAGACGAGGAGCTGGATGTGTTGAGGAA
GAGAGGTGGCATCCGCGGCAAAAGCTTTGCAGAGCGGCTTCCTAAAGTACAGAGGAAAGACAAGGTTAGCCGTCT
GACGGCCTACTGCACGGCTCAGGCGTTCAAGGTCGGCGCCACATCCGAGTTCCTGAGGAAGAAGCACGAGGCGAA
AACGAAACTCTACGACGACTGTCTCTACGTCATATACGCCCTACCCTTGCTCAACGGAACCGATGGCTACCGGGT
CCGCGGCCGGCCCATGCTCAAGACTCCGGGGACAGGCAAAACCATGCTTGATCTGGAGATTGAGCGAAGCGAGCG
TCGAGACCATTACGAAGGATACTTTGAGGATGACGCATACACAAATCCTGAGAGTCCGGACAGAGGCAGTCGCGC
GACGCCGCCCTTTGGCGACCCGTCTCCCGACGACGATATGCACAGGGAGCACGACGACGGGTTCCGATCGCACAT
CAATCGCATCGCGCCCGACGCTAAGAGCTTCGCCGAGATGTTTGTCTTCTCCTACGGCGTAGTCGTCTTCTGGAA
CTTCACAGAGCATCAGGAAAAGGACATCCTCGCGGATCTGACATTCGCCGACGCCCAAGACGGCATCAGCCTCCT
GACCAGGCCATTCGAGCAAGACACGTTCGAGACGGAAGAGTTTCACTTCGAGTACAGCGCCGACGTCAAGCGGCC
GCGAGTGTTTAACGACATGATTACGCTGATGCCGCGGTCGGACCACATGATCAAGCTGACCATCAGCCACTCGAT
CGCGCAGAGCACCAAGCTGTGTTTCTTTGAGGAGCGGATGAGCGAGACGATGCTTGATGCGCAGCACGTGCCCAA
GAGGCTGGCCTTGACCGGGCATCTCAACATGACGAGAACGGAGATTGTCAAGATACTCGGCAGGCTGTTTAAGAG
CCGCGTCGACATCAATCTGTGTAAGCTGGAAGAGCTGACAAGGGAGAAGATAAATTGCTGACGAGCTCACTGCAG
CATCCAATATTCTCGACGTGCCCAACTTCTTCTGGGACTCGGAACCGACACTGCATCCGCTTTACGTGGCGGTGC
GCGAATACCTCGAGATCGACCCTCGTATCAAGGTGCTCAACGAGCGATGCCGCGTCTTCCTCGACCTGGCCGAGA
TCCTGTCGGACTCGGTCAACGACGCCAAGATGAGTTACATTACGTGGATCATCATCATCCTCATCGTCGTCAGCA
TCCTCGTCACCGTCACCGAAGTCGGGCTGCGGTTCGGCATGCTTAGCAAGAGTTCGAACAAGGCCAAGGGCTTGG
CGGGCGTGACAGCCATCAGTTGGGCTGGGGGTCGCAGCCCGGGCGCGGTGCCCGAGATGATACTCGTTCCCCCGC
CGGCGGCGGCGGACGTGGACGAAATAGGGAAGCTCGCTCTAGTGCTCGGCCTGCAGTCCAACGCCAGCTTCGACG
ACGTGCAACAAGGTATCATCGACTTGAGGCGGGCGGCGGCGCGTCGGCGTCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail