Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03312
Gene name
Locationscaffold_03:2323815..2328839
Strand-
Gene length (bp)5024
Transcript length (bp)4953
Coding sequence length (bp)4953
Protein length (aa) 1651

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 3.9E-49 1022 1230
PF03836 RasGAP_C RasGAP C-terminus 1.5E-47 1430 1570
PF00307 CH Calponin homology (CH) domain 2.2E-10 269 368
PF00612 IQ IQ calmodulin-binding motif 3.2E-03 499 519

GO

GO Term Description Terminal node
GO:0043087 regulation of GTPase activity Yes
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0050790 regulation of catalytic activity No
GO:0008150 biological_process No
GO:0065009 regulation of molecular function No
GO:0051336 regulation of hydrolase activity No
GO:0005488 binding No
GO:0065007 biological regulation No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7761 0.3396 0.1157 0.3206 0.0892 0.0084 0.1574 0.2735 0.1785 0.0051

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2432
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4683
Ophiocordyceps australis map64 (Brazil) OphauB2|4493
Ophiocordyceps camponoti-floridani Ophcf2|03312 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5346
Ophiocordyceps kimflemingae Ophio5|3524
Ophiocordyceps subramaniannii Hirsu2|3452

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03312
MSSQPQPLRNALAVDPLSPSRDILGRYPSTSSSGATKSSQHCRVQSDVLARARNFEAGAMDVSVASPGSPRGLNR
KSLCLLPQGPASSPPRPPGTPPGSKVARHERGKSVDVGRLAFALADGPPSPVSPLRPKSARPISMLLTRSDTGLV
ASATSANSNNSSSNNNNASQPIHHAPIGRPDLELLGKSSTRELRTLSRLAQSESADGFAITSPAQEVVGLRGRRR
LQRMDKPNGGRDSKTAGYSWEGRNWMDKQRQFLQAYEYLCHIGEAKEWVEDVISKSLPPIVELEEALRDGVTLAE
IVEALNPDKRYRIFHHPKLQYRHSDNIAIFFRYLDEVELPDLFRFELIDLYEKKNIPKVIYCIHALSWLLFRKGI
VDFRIGNLVGQLEFEPHELEAMQKGLDKLGANMPSFGNMGADFGVAEPEPEPQETEQERIDRELSEVEETILELQ
AQSRGSMLRMRLGTTMQQLWDSEDSLVDLQSRIRGDFTRQIMSYRLQMRRSAILVQSSVRGFLVRQRLRQNDQSC
KALEPLILDLQSAIRANKVRGDLRDLRSLLETRSGPVRDVQAKSRGFLARQKHVAQQRETRATSEPVRKLQAAAR
AMLLRDRVHDKLRLLDDSADVIAHLQAAARGSQTRARLAGEWEHLRASESTWTSLQAEIRGATARGRHLALNSEL
EQQAGGVAQLQASIRAALMRREVTAQLDELESHREDVAAVQSRIRGVLLRRDISALGRRLDRHAGPIVDLQACGR
GQLVRQHCEALLEELHSHDGSVAAFQAILKAMMERARIEDLVAELTEEEEFIVAFQSAAKGFLVRARFEEKKRFF
DENMQKVVKIQSFVRAKVQGEAYKSLTTGKNPPVNAVKNFVHLLNDSDFDFNEELEFERMRKTVVQQVRQNEMLE
QYIDQLDIKIALLVKNKITLDEVVRHQHNYGGSSVGLLANSSMSSNNQFDLKALNKSSRKKLESYQQLFFSLQTQ
PQYLARLFKRMREQGTAEKECKRIELLIMSLFGYAQKRREEYYLLKLIARSIREEIEGAVMLQEYVRGNYFWARL
LGNYTRSPRDRKYLRSLLGPLIRDNFIEDPALDLESDPMQIYRSAINNEELRTGRPDQRPLDVPREVAIRDPETR
RLFIDHLRDLREICDQFFTALEDLLHKMPYGLRFLCGQMFDALCQHFTREPQGQLLQVVANWLWKFYLQPALTSP
EHVGVVERTLSPLQKRNLGEVAKVIGQVASGRPFGGENIYLQPLNAFVAESMDRLRLMMRELMAVPDAERTFDID
EFNDLYAKNKPTLYVKLTDIFAMHNLVAAELATMCPTRDDVLGEIMSDLGSAKSNENEMKAAGSSDIHMFLTPKL
HDVDDPEEEVKALFMETKRCVLYIIRVQTGANLLDILVKPITAEDEQRWRDLLRDDFSDDSETRGAYSDANMVDV
TRMTYHELKRTALENVMRLEQMGRISKHNLYQDVLNAIASDIRTKSRRRVQRQRELEGVRLTLGNLHEKAKYLEQ
QRRSYDDYIEQAMATLQNKKGKKRFLLPFTKQYNHQRELERSGRVPKFGSFKYSARALSDKGVLVSWSGLGDRDV
DKINMTISCDEVGIFALEGSRGHIQMPGASALVSIEDLLQAQFESHQFMHIFEGNLKLNVNLLLHLIYKKFYRTA
*
Coding >Ophcf2|03312
ATGTCCTCCCAGCCTCAGCCGCTCCGCAATGCGCTCGCCGTCGACCCTCTCTCCCCTTCCCGCGATATTCTCGGC
CGATATCCCTCGACTTCTTCCAGCGGTGCTACCAAGTCCTCACAACACTGTCGCGTTCAGAGCGATGTCTTAGCT
CGTGCCCGCAACTTCGAAGCCGGCGCAATGGACGTTTCCGTTGCCTCCCCCGGGAGCCCTCGGGGTCTCAATCGC
AAGTCGCTTTGTCTCCTCCCTCAGGGCCCGGCCTCGTCTCCGCCCCGTCCGCCGGGTACCCCTCCGGGTAGCAAG
GTCGCCAGACATGAGCGAGGCAAGAGTGTCGACGTCGGCAGGCTGGCTTTTGCGCTGGCCGATGGCCCTCCTTCT
CCCGTCTCGCCTCTACGGCCCAAGTCTGCGCGGCCCATCTCGATGTTGCTGACCCGGTCCGATACTGGCCTCGTA
GCAAGCGCCACCTCCGCCAACAGCAATAACAGCAGCAGCAACAACAACAACGCTTCGCAGCCGATTCATCATGCC
CCCATCGGCCGACCTGACCTCGAACTTCTCGGAAAATCCTCCACGCGGGAGCTGCGCACCCTGTCGCGTCTCGCC
CAGTCTGAGTCTGCTGATGGCTTCGCTATCACGTCACCTGCCCAAGAGGTCGTCGGGCTCCGCGGCCGGCGCCGG
CTACAGCGCATGGACAAGCCCAATGGTGGCCGCGACTCTAAGACGGCTGGCTACAGCTGGGAGGGTCGCAACTGG
ATGGACAAGCAGCGCCAGTTTCTTCAGGCCTACGAGTACCTCTGCCACATAGGTGAGGCCAAGGAATGGGTCGAA
GACGTCATCAGCAAGTCCCTGCCTCCCATTGTCGAACTCGAAGAGGCCCTCCGAGATGGCGTCACACTAGCCGAG
ATTGTTGAAGCACTCAACCCCGACAAGCGTTACCGAATATTCCACCACCCTAAACTTCAGTACCGTCACTCCGAC
AATATCGCCATCTTCTTCCGCTACCTCGACGAGGTCGAGCTCCCCGACCTATTCCGGTTCGAGCTCATAGATCTA
TACGAAAAGAAGAACATACCCAAGGTCATATACTGCATTCACGCCCTGAGTTGGTTGCTTTTCCGCAAGGGCATC
GTCGATTTCCGGATAGGCAACCTCGTCGGGCAGCTCGAGTTTGAGCCTCACGAGCTCGAGGCTATGCAAAAGGGT
CTCGATAAGCTGGGGGCCAACATGCCGAGCTTCGGTAATATGGGAGCCGACTTTGGCGTCGCCGAGCCTGAGCCC
GAACCGCAAGAGACAGAACAGGAAAGAATCGATCGGGAGCTGTCAGAGGTCGAGGAGACCATACTCGAGCTGCAG
GCGCAGAGTCGCGGTTCTATGCTGCGAATGCGCCTCGGCACGACGATGCAACAATTGTGGGACAGCGAGGACAGT
CTCGTCGACTTGCAGTCACGCATCCGAGGTGACTTTACGCGTCAAATTATGAGCTATCGGCTTCAGATGCGAAGG
TCCGCTATCCTTGTCCAGAGTTCTGTGCGCGGCTTTCTCGTTCGCCAGAGGTTACGGCAGAACGACCAGTCTTGC
AAGGCTCTGGAGCCTCTCATCTTGGACTTGCAGAGCGCCATTCGCGCCAACAAAGTCCGCGGGGATCTGCGAGAC
CTCAGATCTCTCTTGGAGACGCGCAGCGGACCTGTCCGGGATGTCCAGGCCAAGTCCCGGGGCTTTTTGGCCCGT
CAAAAGCACGTAGCGCAGCAACGAGAGACAAGGGCCACGTCGGAGCCCGTTCGGAAACTGCAAGCTGCCGCCAGA
GCGATGTTACTGAGGGACAGAGTCCACGACAAGCTTCGTCTTCTGGACGACAGTGCCGATGTCATTGCTCACCTA
CAGGCTGCTGCCAGAGGCTCTCAGACCAGGGCCCGGCTTGCTGGCGAGTGGGAGCATCTGCGAGCGTCCGAGTCG
ACGTGGACCTCGCTTCAGGCCGAGATCCGGGGAGCCACCGCCCGAGGTCGGCATCTGGCCCTCAACAGCGAGCTG
GAGCAACAGGCTGGAGGCGTCGCGCAACTCCAAGCGTCAATACGAGCTGCATTGATGCGGAGAGAGGTGACAGCT
CAGCTCGACGAGTTGGAGTCGCACAGGGAAGATGTTGCGGCCGTTCAGTCTCGCATCCGAGGTGTGCTGCTACGA
CGGGACATTTCCGCGCTCGGACGACGTCTCGACCGTCACGCCGGTCCAATCGTCGACCTGCAGGCGTGCGGTCGA
GGACAGCTCGTCCGGCAACATTGCGAAGCCCTGCTGGAAGAGCTACATTCTCACGACGGATCGGTTGCTGCCTTC
CAGGCCATCTTAAAAGCCATGATGGAGCGTGCACGAATCGAGGACCTGGTGGCCGAATTGACGGAAGAAGAGGAG
TTCATCGTTGCCTTTCAGTCCGCGGCTAAGGGATTCCTTGTTCGAGCTCGGTTCGAGGAGAAGAAGCGGTTCTTT
GACGAGAACATGCAGAAAGTGGTCAAGATCCAGAGTTTTGTGCGGGCCAAGGTGCAGGGCGAGGCGTACAAGAGC
CTCACGACTGGCAAGAACCCGCCGGTGAACGCGGTCAAGAACTTTGTGCACCTGCTCAACGACAGTGACTTTGAC
TTCAACGAGGAGCTCGAGTTTGAGAGGATGCGCAAAACGGTGGTGCAACAGGTGCGACAGAACGAGATGCTGGAG
CAGTACATTGACCAGCTCGACATCAAGATCGCCCTCCTTGTGAAGAACAAGATTACGCTGGACGAGGTTGTGCGG
CATCAGCACAACTACGGAGGCAGCTCGGTCGGTCTCCTGGCCAACTCTTCCATGTCGTCCAACAACCAGTTCGAC
CTCAAGGCTCTCAACAAGAGCTCGCGGAAGAAGCTCGAGTCGTACCAACAGCTCTTCTTCAGCCTGCAGACGCAG
CCGCAGTACTTGGCCCGGCTCTTCAAGCGCATGCGCGAGCAAGGTACAGCAGAGAAGGAGTGCAAGAGGATCGAA
CTTCTCATCATGAGTCTCTTTGGCTATGCGCAAAAGCGACGAGAGGAATACTACCTGCTGAAGCTGATTGCGAGA
TCGATCCGCGAAGAGATTGAGGGCGCGGTCATGCTGCAGGAGTACGTCCGAGGTAACTACTTCTGGGCGAGGCTG
CTGGGCAACTACACGCGCTCGCCGAGGGATCGCAAGTATCTGCGAAGCCTCCTCGGGCCGCTGATCCGGGACAAC
TTCATCGAGGACCCGGCACTGGACCTGGAAAGCGATCCGATGCAGATCTACCGGTCGGCCATCAACAACGAGGAG
CTGCGGACCGGACGACCCGACCAGCGACCGCTGGATGTGCCTCGCGAGGTGGCCATCCGGGACCCGGAAACGCGA
AGGCTCTTCATCGACCACCTGCGAGACCTGCGCGAGATCTGCGACCAGTTCTTCACGGCGCTCGAGGACTTGCTG
CACAAGATGCCCTACGGACTCCGCTTCCTGTGCGGGCAGATGTTCGACGCGCTCTGCCAGCACTTTACGAGGGAG
CCGCAGGGCCAGCTGCTGCAGGTGGTGGCCAACTGGCTGTGGAAGTTTTACCTGCAGCCGGCGCTGACGTCGCCG
GAACACGTGGGTGTGGTGGAGAGGACGCTGAGTCCCCTGCAGAAGAGGAACCTGGGCGAGGTGGCCAAGGTGATC
GGACAGGTGGCTTCGGGGCGGCCGTTTGGGGGGGAGAACATTTACCTGCAGCCCCTCAACGCGTTCGTGGCGGAG
TCGATGGATCGGCTGCGGCTGATGATGAGGGAGCTGATGGCGGTGCCGGACGCGGAGCGGACGTTTGATATCGAC
GAGTTCAACGACCTGTACGCCAAGAACAAGCCGACGCTGTACGTCAAGCTGACGGACATATTCGCCATGCACAAC
CTGGTGGCGGCGGAGCTGGCGACCATGTGCCCGACGCGTGACGACGTCCTGGGCGAGATCATGAGCGACCTGGGG
AGCGCTAAGAGCAACGAGAACGAGATGAAGGCGGCAGGGTCGTCGGATATTCACATGTTCCTGACGCCCAAGTTG
CACGACGTCGACGACCCGGAGGAGGAGGTCAAGGCCTTGTTTATGGAGACGAAGCGCTGCGTGCTGTACATTATC
AGGGTACAGACGGGCGCCAACCTCTTGGACATTCTTGTCAAGCCCATCACGGCCGAGGACGAGCAGCGGTGGCGG
GACCTGCTCCGGGACGACTTCTCAGACGACAGCGAGACGCGGGGAGCCTACTCGGACGCCAACATGGTGGACGTG
ACGCGGATGACGTACCACGAGCTCAAGCGGACGGCGCTGGAGAATGTGATGCGGCTGGAGCAGATGGGCCGCATC
TCCAAGCACAACCTGTACCAGGACGTGCTAAACGCCATAGCCAGCGACATCCGGACCAAGAGCCGGCGGCGGGTG
CAGAGGCAGAGGGAGCTCGAGGGCGTGCGACTGACGCTGGGCAATCTCCACGAAAAGGCCAAGTACCTGGAGCAG
CAGCGGAGAAGCTACGACGACTACATCGAGCAGGCCATGGCGACGCTGCAGAACAAGAAGGGGAAGAAGCGATTC
TTATTGCCCTTTACGAAGCAGTACAACCACCAGCGCGAGCTGGAGCGCAGCGGGCGCGTGCCCAAGTTCGGCAGC
TTCAAGTACAGCGCGCGGGCGCTTTCGGATAAGGGGGTGCTCGTCTCGTGGAGCGGACTCGGAGACCGCGACGTG
GACAAGATCAACATGACGATATCGTGCGACGAGGTGGGCATCTTCGCGCTCGAGGGGTCACGCGGACACATCCAG
ATGCCCGGGGCCAGCGCGCTGGTGTCTATCGAGGACCTGTTGCAGGCCCAGTTCGAGTCGCACCAGTTCATGCAC
ATCTTTGAGGGCAACTTGAAGCTCAACGTCAACCTGCTGTTGCACCTCATCTACAAGAAGTTTTACCGGACGGCG
TGA
Transcript >Ophcf2|03312
ATGTCCTCCCAGCCTCAGCCGCTCCGCAATGCGCTCGCCGTCGACCCTCTCTCCCCTTCCCGCGATATTCTCGGC
CGATATCCCTCGACTTCTTCCAGCGGTGCTACCAAGTCCTCACAACACTGTCGCGTTCAGAGCGATGTCTTAGCT
CGTGCCCGCAACTTCGAAGCCGGCGCAATGGACGTTTCCGTTGCCTCCCCCGGGAGCCCTCGGGGTCTCAATCGC
AAGTCGCTTTGTCTCCTCCCTCAGGGCCCGGCCTCGTCTCCGCCCCGTCCGCCGGGTACCCCTCCGGGTAGCAAG
GTCGCCAGACATGAGCGAGGCAAGAGTGTCGACGTCGGCAGGCTGGCTTTTGCGCTGGCCGATGGCCCTCCTTCT
CCCGTCTCGCCTCTACGGCCCAAGTCTGCGCGGCCCATCTCGATGTTGCTGACCCGGTCCGATACTGGCCTCGTA
GCAAGCGCCACCTCCGCCAACAGCAATAACAGCAGCAGCAACAACAACAACGCTTCGCAGCCGATTCATCATGCC
CCCATCGGCCGACCTGACCTCGAACTTCTCGGAAAATCCTCCACGCGGGAGCTGCGCACCCTGTCGCGTCTCGCC
CAGTCTGAGTCTGCTGATGGCTTCGCTATCACGTCACCTGCCCAAGAGGTCGTCGGGCTCCGCGGCCGGCGCCGG
CTACAGCGCATGGACAAGCCCAATGGTGGCCGCGACTCTAAGACGGCTGGCTACAGCTGGGAGGGTCGCAACTGG
ATGGACAAGCAGCGCCAGTTTCTTCAGGCCTACGAGTACCTCTGCCACATAGGTGAGGCCAAGGAATGGGTCGAA
GACGTCATCAGCAAGTCCCTGCCTCCCATTGTCGAACTCGAAGAGGCCCTCCGAGATGGCGTCACACTAGCCGAG
ATTGTTGAAGCACTCAACCCCGACAAGCGTTACCGAATATTCCACCACCCTAAACTTCAGTACCGTCACTCCGAC
AATATCGCCATCTTCTTCCGCTACCTCGACGAGGTCGAGCTCCCCGACCTATTCCGGTTCGAGCTCATAGATCTA
TACGAAAAGAAGAACATACCCAAGGTCATATACTGCATTCACGCCCTGAGTTGGTTGCTTTTCCGCAAGGGCATC
GTCGATTTCCGGATAGGCAACCTCGTCGGGCAGCTCGAGTTTGAGCCTCACGAGCTCGAGGCTATGCAAAAGGGT
CTCGATAAGCTGGGGGCCAACATGCCGAGCTTCGGTAATATGGGAGCCGACTTTGGCGTCGCCGAGCCTGAGCCC
GAACCGCAAGAGACAGAACAGGAAAGAATCGATCGGGAGCTGTCAGAGGTCGAGGAGACCATACTCGAGCTGCAG
GCGCAGAGTCGCGGTTCTATGCTGCGAATGCGCCTCGGCACGACGATGCAACAATTGTGGGACAGCGAGGACAGT
CTCGTCGACTTGCAGTCACGCATCCGAGGTGACTTTACGCGTCAAATTATGAGCTATCGGCTTCAGATGCGAAGG
TCCGCTATCCTTGTCCAGAGTTCTGTGCGCGGCTTTCTCGTTCGCCAGAGGTTACGGCAGAACGACCAGTCTTGC
AAGGCTCTGGAGCCTCTCATCTTGGACTTGCAGAGCGCCATTCGCGCCAACAAAGTCCGCGGGGATCTGCGAGAC
CTCAGATCTCTCTTGGAGACGCGCAGCGGACCTGTCCGGGATGTCCAGGCCAAGTCCCGGGGCTTTTTGGCCCGT
CAAAAGCACGTAGCGCAGCAACGAGAGACAAGGGCCACGTCGGAGCCCGTTCGGAAACTGCAAGCTGCCGCCAGA
GCGATGTTACTGAGGGACAGAGTCCACGACAAGCTTCGTCTTCTGGACGACAGTGCCGATGTCATTGCTCACCTA
CAGGCTGCTGCCAGAGGCTCTCAGACCAGGGCCCGGCTTGCTGGCGAGTGGGAGCATCTGCGAGCGTCCGAGTCG
ACGTGGACCTCGCTTCAGGCCGAGATCCGGGGAGCCACCGCCCGAGGTCGGCATCTGGCCCTCAACAGCGAGCTG
GAGCAACAGGCTGGAGGCGTCGCGCAACTCCAAGCGTCAATACGAGCTGCATTGATGCGGAGAGAGGTGACAGCT
CAGCTCGACGAGTTGGAGTCGCACAGGGAAGATGTTGCGGCCGTTCAGTCTCGCATCCGAGGTGTGCTGCTACGA
CGGGACATTTCCGCGCTCGGACGACGTCTCGACCGTCACGCCGGTCCAATCGTCGACCTGCAGGCGTGCGGTCGA
GGACAGCTCGTCCGGCAACATTGCGAAGCCCTGCTGGAAGAGCTACATTCTCACGACGGATCGGTTGCTGCCTTC
CAGGCCATCTTAAAAGCCATGATGGAGCGTGCACGAATCGAGGACCTGGTGGCCGAATTGACGGAAGAAGAGGAG
TTCATCGTTGCCTTTCAGTCCGCGGCTAAGGGATTCCTTGTTCGAGCTCGGTTCGAGGAGAAGAAGCGGTTCTTT
GACGAGAACATGCAGAAAGTGGTCAAGATCCAGAGTTTTGTGCGGGCCAAGGTGCAGGGCGAGGCGTACAAGAGC
CTCACGACTGGCAAGAACCCGCCGGTGAACGCGGTCAAGAACTTTGTGCACCTGCTCAACGACAGTGACTTTGAC
TTCAACGAGGAGCTCGAGTTTGAGAGGATGCGCAAAACGGTGGTGCAACAGGTGCGACAGAACGAGATGCTGGAG
CAGTACATTGACCAGCTCGACATCAAGATCGCCCTCCTTGTGAAGAACAAGATTACGCTGGACGAGGTTGTGCGG
CATCAGCACAACTACGGAGGCAGCTCGGTCGGTCTCCTGGCCAACTCTTCCATGTCGTCCAACAACCAGTTCGAC
CTCAAGGCTCTCAACAAGAGCTCGCGGAAGAAGCTCGAGTCGTACCAACAGCTCTTCTTCAGCCTGCAGACGCAG
CCGCAGTACTTGGCCCGGCTCTTCAAGCGCATGCGCGAGCAAGGTACAGCAGAGAAGGAGTGCAAGAGGATCGAA
CTTCTCATCATGAGTCTCTTTGGCTATGCGCAAAAGCGACGAGAGGAATACTACCTGCTGAAGCTGATTGCGAGA
TCGATCCGCGAAGAGATTGAGGGCGCGGTCATGCTGCAGGAGTACGTCCGAGGTAACTACTTCTGGGCGAGGCTG
CTGGGCAACTACACGCGCTCGCCGAGGGATCGCAAGTATCTGCGAAGCCTCCTCGGGCCGCTGATCCGGGACAAC
TTCATCGAGGACCCGGCACTGGACCTGGAAAGCGATCCGATGCAGATCTACCGGTCGGCCATCAACAACGAGGAG
CTGCGGACCGGACGACCCGACCAGCGACCGCTGGATGTGCCTCGCGAGGTGGCCATCCGGGACCCGGAAACGCGA
AGGCTCTTCATCGACCACCTGCGAGACCTGCGCGAGATCTGCGACCAGTTCTTCACGGCGCTCGAGGACTTGCTG
CACAAGATGCCCTACGGACTCCGCTTCCTGTGCGGGCAGATGTTCGACGCGCTCTGCCAGCACTTTACGAGGGAG
CCGCAGGGCCAGCTGCTGCAGGTGGTGGCCAACTGGCTGTGGAAGTTTTACCTGCAGCCGGCGCTGACGTCGCCG
GAACACGTGGGTGTGGTGGAGAGGACGCTGAGTCCCCTGCAGAAGAGGAACCTGGGCGAGGTGGCCAAGGTGATC
GGACAGGTGGCTTCGGGGCGGCCGTTTGGGGGGGAGAACATTTACCTGCAGCCCCTCAACGCGTTCGTGGCGGAG
TCGATGGATCGGCTGCGGCTGATGATGAGGGAGCTGATGGCGGTGCCGGACGCGGAGCGGACGTTTGATATCGAC
GAGTTCAACGACCTGTACGCCAAGAACAAGCCGACGCTGTACGTCAAGCTGACGGACATATTCGCCATGCACAAC
CTGGTGGCGGCGGAGCTGGCGACCATGTGCCCGACGCGTGACGACGTCCTGGGCGAGATCATGAGCGACCTGGGG
AGCGCTAAGAGCAACGAGAACGAGATGAAGGCGGCAGGGTCGTCGGATATTCACATGTTCCTGACGCCCAAGTTG
CACGACGTCGACGACCCGGAGGAGGAGGTCAAGGCCTTGTTTATGGAGACGAAGCGCTGCGTGCTGTACATTATC
AGGGTACAGACGGGCGCCAACCTCTTGGACATTCTTGTCAAGCCCATCACGGCCGAGGACGAGCAGCGGTGGCGG
GACCTGCTCCGGGACGACTTCTCAGACGACAGCGAGACGCGGGGAGCCTACTCGGACGCCAACATGGTGGACGTG
ACGCGGATGACGTACCACGAGCTCAAGCGGACGGCGCTGGAGAATGTGATGCGGCTGGAGCAGATGGGCCGCATC
TCCAAGCACAACCTGTACCAGGACGTGCTAAACGCCATAGCCAGCGACATCCGGACCAAGAGCCGGCGGCGGGTG
CAGAGGCAGAGGGAGCTCGAGGGCGTGCGACTGACGCTGGGCAATCTCCACGAAAAGGCCAAGTACCTGGAGCAG
CAGCGGAGAAGCTACGACGACTACATCGAGCAGGCCATGGCGACGCTGCAGAACAAGAAGGGGAAGAAGCGATTC
TTATTGCCCTTTACGAAGCAGTACAACCACCAGCGCGAGCTGGAGCGCAGCGGGCGCGTGCCCAAGTTCGGCAGC
TTCAAGTACAGCGCGCGGGCGCTTTCGGATAAGGGGGTGCTCGTCTCGTGGAGCGGACTCGGAGACCGCGACGTG
GACAAGATCAACATGACGATATCGTGCGACGAGGTGGGCATCTTCGCGCTCGAGGGGTCACGCGGACACATCCAG
ATGCCCGGGGCCAGCGCGCTGGTGTCTATCGAGGACCTGTTGCAGGCCCAGTTCGAGTCGCACCAGTTCATGCAC
ATCTTTGAGGGCAACTTGAAGCTCAACGTCAACCTGCTGTTGCACCTCATCTACAAGAAGTTTTACCGGACGGCG
TGA
Gene >Ophcf2|03312
ATGTCCTCCCAGCCTCAGCCGCTCCGCAATGCGCTCGCCGTCGACCCTCTCTCCCCTTCCCGCGATATTCTCGGC
CGATATCCCTCGACTTCTTCCAGCGGTGCTACCAAGTCCTCACAACACTGTCGCGTTCAGAGCGATGTCTTAGCT
CGTGCCCGCAACTTCGAAGCCGGCGCAATGGACGTTTCCGTTGCCTCCCCCGGGAGCCCTCGGGGTCTCAATCGC
AAGTCGCTTTGTCTCCTCCCTCAGGGCCCGGCCTCGTCTCCGCCCCGTCCGCCGGGTACCCCTCCGGGTAGCAAG
GTCGCCAGACATGAGCGAGGCAAGAGTGTCGACGTCGGCAGGCTGGCTTTTGCGCTGGCCGATGGCCCTCCTTCT
CCCGTCTCGCCTCTACGGCCCAAGTCTGCGCGGCCCATCTCGATGTTGCTGACCCGGTCCGATACTGGCCTCGTA
GCAAGCGCCACCTCCGCCAACAGCAATAACAGCAGCAGCAACAACAACAACGCTTCGCAGCCGATTCATCATGCC
CCCATCGGCCGACCTGACCTCGAACTTCTCGGAAAATCCTCCACGCGGGAGCTGCGCACCCTGTCGCGTCTCGCC
CAGTCTGAGTCTGCTGATGGCTTCGCTATCACGTCACCTGCCCAAGAGGTCGTCGGGCTCCGCGGCCGGCGCCGG
CTACAGCGCATGGACAAGCCCAATGGTGGCCGCGACTCTAAGACGGCTGGCTACAGCTGGGAGGGTCGCAACTGG
ATGGACAAGCAGCGCCAGTTTCTTCAGGCCTACGAGTACCTCTGCCACATAGGTGAGGCCAAGGAATGGGTCGAA
GACGTCATCAGCAAGTCCCTGCCTCCCATTGTCGAACTCGAAGAGGCCCTCCGAGATGGCGTCACACTAGCCGAG
ATTGTTGAAGCACTCAACCCCGACAAGCGTTACCGAATATTCCACCACCCTAAACTTCAGTACCGTCACTCCGAC
AATATCGCCATCTTCTTCCGCTACCTCGACGAGGTCGAGCTCCCCGACCTATTCCGGTTCGAGCTCATAGATCTA
TACGAAAAGAAGAACATACCCAAGGTCATATACTGCATTCACGCCCTGAGTTGGTTGCTTTTCCGCAAGGGCATC
GTCGATTTCCGGATAGGCAACCTCGTCGGGCAGCTCGAGTTTGAGCCTCACGAGCTCGAGGCTATGCAAAAGGGT
CTCGATAAGCTGGGGGCCAACATGCCGAGCTTCGGTAATATGGGAGCCGACTTTGGCGTCGCCGAGCCTGAGCCC
GAACCGCAAGAGACAGAACAGGAAAGAATCGATCGGGAGCTGTCAGAGGTCGAGGAGACCATACTCGAGCTGCAG
GCGCAGAGTCGCGGTTCTATGCTGCGAATGCGCCTCGGCACGACGATGCAACAATTGTGGGACAGCGAGGACAGT
CTCGTCGACTTGCAGTCACGCATCCGAGGTGACTTTACGCGTCAAATTATGAGCTATCGGCTTCAGATGCGAAGG
TCCGCTATCCTTGTCCAGAGTTCTGTGCGCGGCTTTCTCGTTCGCCAGAGGTTACGGCAGAACGACCAGTCTTGC
AAGGCTCTGGAGCCTCTCATCTTGGACTTGCAGAGCGCCATTCGCGCCAACAAAGTCCGCGGGGATCTGCGAGAC
CTCAGATCTCTCTTGGAGACGCGCAGCGGACCTGTCCGGGATGTCCAGGCCAAGTCCCGGGGCTTTTTGGCCCGT
CAAAAGCACGTAGCGCAGCAACGAGAGACAAGGGCCACGTCGGAGCCCGTTCGGAAACTGCAAGCTGCCGCCAGA
GCGATGTTACTGAGGGACAGAGTCCACGACAAGCTTCGTCTTCTGGACGACAGTGCCGATGTCATTGCTCACCTA
CAGGCTGCTGCCAGAGGCTCTCAGACCAGGGCCCGGCTTGCTGGCGAGTGGGAGCATCTGCGAGCGTCCGAGTCG
ACGTGGACCTCGCTTCAGGCCGAGATCCGGGGAGCCACCGCCCGAGGTCGGCATCTGGCCCTCAACAGCGAGCTG
GAGCAACAGGCTGGAGGCGTCGCGCAACTCCAAGCGTCAATACGAGCTGCATTGATGCGGAGAGAGGTGACAGCT
CAGCTCGACGAGTTGGAGTCGCACAGGGAAGATGTTGCGGCCGTTCAGTCTCGCATCCGAGGTGTGCTGCTACGA
CGGGACATTTCCGCGCTCGGACGACGTCTCGACCGTCACGCCGGTCCAATCGTCGACCTGCAGGCGTGCGGTCGA
GGACAGCTCGTCCGGCAACATTGCGAAGCCCTGCTGGAAGAGCTACATTCTCACGACGGATCGGTTGCTGCCTTC
CAGGCCATCTTAAAAGCCATGATGGAGCGTGCACGAATCGAGGACCTGGTGGCCGAATTGACGGAAGAAGAGGAG
TTCATCGTTGCCTTTCAGTCCGCGGCTAAGGGATTCCTTGTTCGAGCTCGGTTCGAGGAGAAGAAGCGGTTCTTT
GACGAGAACATGCAGAAAGTGGTCAAGATCCAGAGTTTTGTGCGGGCCAAGGTGCAGGGCGAGGCGTACAAGAGC
CTCACGACTGGCAAGAACCCGCCGGTGAACGCGGTCAAGAACTTTGTGCACCTGCTCAACGACAGTGACTTTGAC
TTCAACGAGGAGCTCGAGTTTGAGAGGATGCGCAAAACGGTGGTGCAACAGGTGCGACAGAACGAGATGCTGGAG
CAGTACATTGACCAGCTCGACATCAAGATCGCCCTCCTTGTGAAGAACAAGATTACGCTGGACGAGGTTGTGCGG
CATCAGCACAACTACGGAGGCAGCTCGGTCGGTCTCCTGGCCAACTCTTCCATGTCGTCCAACAACCAGTTCGAC
CTCAAGGCTCTCAACAAGAGCTCGCGGAAGAAGCTCGAGTCGTACCAACAGCTCTTCTTCAGCCTGCAGACGCAG
CCGCAGTACTTGGCCCGGCTCTTCAAGCGCATGCGCGAGCAAGGTACAGCAGAGAAGGAGTGCAAGAGGATCGAA
CTTCTCATCATGAGTCTCTTTGGCTATGCGCAAAAGCGACGAGAGGAATACTACCTGCTGAAGCTGATTGCGAGA
TCGATCCGCGAAGAGATTGAGGGCGCGGTCATGCTGCAGGAGTACGTCCGAGGTAACTACTTCTGGGCGAGGCTG
CTGGGCAACTACACGCGCTCGCCGAGGGATCGCAAGTATCTGCGAAGCCTCCTCGGGCCGCTGATCCGGGACAAC
TTCATCGAGGACCCGGCACTGGACCTGGAAAGCGATCCGATGCAGATCTACCGGTCGGCCATCAACAACGAGGAG
CTGCGGACCGGACGACCCGACCAGCGACCGCTGGATGTGCCTCGCGAGGTGGCCATCCGGGACCCGGAAACGCGA
AGGCTCTTCATCGACCACCTGCGAGACCTGCGCGAGATCTGCGACCAGTTCTTCACGGCGCTCGAGGACTTGCTG
CACAAGATGCCCTACGGACTCCGCTTCCTGTGCGGGCAGATGTTCGACGCGCTCTGCCAGCACTTTACGAGGGAG
CCGCAGGGCCAGCTGCTGCAGGTGGTGGCCAACTGGCTGTGGAAGTTTTACCTGCAGCCGGCGCTGACGTCGCCG
GAACACGTGGGTGTGGTGGAGAGGACGCTGAGTCCCCTGCAGAAGAGGAACCTGGGCGAGGTGGCCAAGGTGATC
GGACAGGTGGCTTCGGGGCGGCCGTTTGGGGGGGAGAACATTTACCTGCAGCCCCTCAACGCGTTCGTGGCGGAG
TCGATGGATCGGCTGCGGCTGATGATGAGGGAGCTGATGGCGGTGCCGGACGCGGAGCGGACGTTTGATATCGAC
GAGTTCAACGACCTGTACGCCAAGAACAAGCCGACGCTGTACGTCAAGCTGACGGACATATTCGCCATGCACAAC
CTGGTGGCGGCGGAGCTGGCGACCATGTGCCCGACGCGTGACGACGTCCTGGGCGAGATCATGAGCGACCTGGGG
AGCGCTAAGAGCAACGAGAACGAGATGAAGGCGGCAGGGTCGTCGGATATTCACATGTTCCTGACGCCCAAGTTG
CACGACGTCGACGACCCGGAGGAGGAGGTCAAGGCCTTGTTTATGGAGACGAAGCGCTGCGTGCTGTACATTATC
AGGGTACAGACGGGCGCCAACCTCTTGGACATTCTTGTCAAGCCCATCACGGCCGAGGACGAGCAGCGGTGGCGG
GACCTGCTCCGGGACGACTTCTCAGACGACAGCGAGACGCGGGGAGCCTACTCGGACGCCAACATGGTGGACGTG
ACGCGGATGACGTACCACGAGCTCAAGCGGACGGCGCTGGAGAATGTGATGCGGCTGGAGCAGATGGGCCGCATC
TCCAAGCACAACCTGTACCAGGACGTGCTAAACGCCATAGCCAGCGACATCCGGACCAAGAGCCGGCGGCGGGTG
CAGAGGCAGAGGGAGCTCGAGGGCGTGCGACTGACGCTGGGCAATCTCCACGAAAAGGCCAAGTACCTGGAGCAG
CAGCGGAGAAGCTACGACGACTACATCGAGCAGGCCATGGCGACGCTGCAGAACAAGAAGGGGTAAGGATGGACG
GTTCGAATAGGAGATGTGTGCGTGGCTGTGGCTGACGAGACTCTCTGCCCTCTCACAGGAAGAAGCGATTCTTAT
TGCCCTTTACGAAGCAGTACAACCACCAGCGCGAGCTGGAGCGCAGCGGGCGCGTGCCCAAGTTCGGCAGCTTCA
AGTACAGCGCGCGGGCGCTTTCGGATAAGGGGGTGCTCGTCTCGTGGAGCGGACTCGGAGACCGCGACGTGGACA
AGATCAACATGACGATATCGTGCGACGAGGTGGGCATCTTCGCGCTCGAGGGGTCACGCGGACACATCCAGATGC
CCGGGGCCAGCGCGCTGGTGTCTATCGAGGACCTGTTGCAGGCCCAGTTCGAGTCGCACCAGTTCATGCACATCT
TTGAGGGCAACTTGAAGCTCAACGTCAACCTGCTGTTGCACCTCATCTACAAGAAGTTTTACCGGACGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail