Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03308
Gene name
Locationscaffold_03:2314393..2316131
Strand-
Gene length (bp)1738
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 34.28 18.66 49.90
Alive In ants, during behavior modification 56.55 31.56 81.53
Dead In ants, recently dead 59.64 33.95 85.32

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.007042 yes
Alive Dead 0.799634 no
Dead Fungus 0.001768 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03308
MHRLEAWIVLAAYLGVLVTGLAYERQEHSLFARHGVRGGPAKVAQVFSAKMGKARGMSKDNANKNQNLNDNNANK
DQGLNNNNNNFDNNNNNNNNNFNDNNNNNGNNFNSNANNGNGNNGNNFNNNNDNFNGNNGNGINFNNGNGNGNGN
GNDFNNAAVTQAVGGSNQQTVTVTVTQTTTVFGNNAASATGAFGQSNAFGANNGNNFNNGNNFNNGNNGNLFNSG
NSGGLGNLGNVNGNNFNANNNLANSAPAKTIIITGASVNGGNVANGASLNNVGTGGTGGTVIVSSQRQTGGTLNN
VGSAGNSAVIISSQKQNNGINTVGGTGGTVLVSSQKQGVGSNVGLVNGVGSNQGSNQGVEIINLAGVNSINNGIR
AVDGQNQCVINGVVMGVLQEQRGEKGKEAPAAKTIPLSDIGLGNAATTTRSQTTAATTPHHPSPPPQQQQQQQQQ
QQQQQQQQQPQQPQQQRQQPPPSAPSPTKSRTPPAQPAQSTTAAAAAPPPANSAAADPKNTVLKSGLDLGALAPE
*
Coding >Ophcf2|03308
ATGCATCGTCTCGAGGCCTGGATCGTCCTGGCGGCATACCTTGGTGTGCTGGTCACTGGGCTCGCGTATGAAAGG
CAAGAGCACAGTCTGTTTGCGAGACATGGCGTCCGCGGGGGTCCCGCGAAAGTGGCGCAGGTCTTTTCCGCAAAG
ATGGGCAAGGCTCGCGGGATGAGCAAGGACAACGCGAACAAGAATCAGAACTTGAACGACAACAATGCCAACAAA
GATCAGGGCCTAAACAACAACAACAACAACTTCGACAACAACAACAACAACAACAACAACAACTTCAACGATAAC
AATAACAACAACGGAAACAACTTTAATAGCAACGCGAATAACGGCAACGGCAACAATGGCAATAATTTCAACAAC
AACAATGACAACTTCAACGGCAACAATGGCAATGGGATCAACTTTAACAACGGTAACGGCAATGGCAATGGCAAT
GGAAACGACTTCAACAACGCCGCCGTGACGCAGGCTGTCGGTGGATCCAACCAGCAGACCGTCACGGTGACCGTT
ACTCAGACGACGACCGTGTTTGGCAATAATGCTGCCTCCGCTACCGGAGCATTCGGCCAGAGCAATGCCTTTGGG
GCCAACAACGGCAACAACTTCAACAACGGGAACAATTTCAACAACGGAAATAACGGGAACCTCTTCAACAGCGGC
AACAGCGGCGGCCTGGGCAACCTAGGCAACGTCAATGGCAACAACTTCAATGCCAACAACAACCTGGCAAACAGT
GCCCCGGCCAAGACCATCATCATCACGGGAGCCAGCGTAAACGGCGGGAACGTCGCTAACGGCGCCAGCCTCAAC
AACGTCGGCACAGGCGGCACAGGCGGCACCGTCATCGTCTCCAGCCAGAGGCAAACCGGCGGCACCTTGAACAAC
GTGGGCAGCGCAGGCAACAGCGCCGTCATCATATCCAGCCAGAAACAAAACAACGGCATAAACACCGTCGGTGGC
ACGGGCGGCACCGTCCTCGTATCCAGCCAGAAACAAGGCGTCGGCAGCAACGTCGGCCTCGTCAACGGCGTCGGC
AGCAACCAAGGCAGCAACCAAGGCGTCGAGATCATCAACCTCGCCGGCGTAAACTCCATCAACAACGGCATCAGA
GCCGTCGACGGCCAGAACCAATGCGTCATCAATGGTGTCGTCATGGGTGTTCTTCAGGAACAGAGGGGGGAGAAG
GGCAAGGAGGCTCCTGCGGCCAAAACGATCCCTCTGTCCGATATTGGTCTCGGAAACGCTGCCACAACGACGAGA
TCGCAAACAACGGCAGCGACAACTCCCCATCACCCCTCCCCTCCGCCCCAACAACAACAACAACAGCAACAACAA
CAACAGCAACAACAACAACAGCAACAACCCCAACAACCCCAACAACAAAGACAACAACCTCCTCCCTCCGCCCCA
AGCCCAACCAAAAGCCGAACCCCCCCAGCCCAACCAGCCCAGTCAACAACCGCCGCCGCCGCAGCACCACCCCCT
GCCAACTCGGCCGCCGCCGACCCCAAAAACACGGTGCTGAAATCCGGGCTTGATTTGGGGGCTCTGGCGCCCGAG
TGA
Transcript >Ophcf2|03308
ATGCATCGTCTCGAGGCCTGGATCGTCCTGGCGGCATACCTTGGTGTGCTGGTCACTGGGCTCGCGTATGAAAGG
CAAGAGCACAGTCTGTTTGCGAGACATGGCGTCCGCGGGGGTCCCGCGAAAGTGGCGCAGGTCTTTTCCGCAAAG
ATGGGCAAGGCTCGCGGGATGAGCAAGGACAACGCGAACAAGAATCAGAACTTGAACGACAACAATGCCAACAAA
GATCAGGGCCTAAACAACAACAACAACAACTTCGACAACAACAACAACAACAACAACAACAACTTCAACGATAAC
AATAACAACAACGGAAACAACTTTAATAGCAACGCGAATAACGGCAACGGCAACAATGGCAATAATTTCAACAAC
AACAATGACAACTTCAACGGCAACAATGGCAATGGGATCAACTTTAACAACGGTAACGGCAATGGCAATGGCAAT
GGAAACGACTTCAACAACGCCGCCGTGACGCAGGCTGTCGGTGGATCCAACCAGCAGACCGTCACGGTGACCGTT
ACTCAGACGACGACCGTGTTTGGCAATAATGCTGCCTCCGCTACCGGAGCATTCGGCCAGAGCAATGCCTTTGGG
GCCAACAACGGCAACAACTTCAACAACGGGAACAATTTCAACAACGGAAATAACGGGAACCTCTTCAACAGCGGC
AACAGCGGCGGCCTGGGCAACCTAGGCAACGTCAATGGCAACAACTTCAATGCCAACAACAACCTGGCAAACAGT
GCCCCGGCCAAGACCATCATCATCACGGGAGCCAGCGTAAACGGCGGGAACGTCGCTAACGGCGCCAGCCTCAAC
AACGTCGGCACAGGCGGCACAGGCGGCACCGTCATCGTCTCCAGCCAGAGGCAAACCGGCGGCACCTTGAACAAC
GTGGGCAGCGCAGGCAACAGCGCCGTCATCATATCCAGCCAGAAACAAAACAACGGCATAAACACCGTCGGTGGC
ACGGGCGGCACCGTCCTCGTATCCAGCCAGAAACAAGGCGTCGGCAGCAACGTCGGCCTCGTCAACGGCGTCGGC
AGCAACCAAGGCAGCAACCAAGGCGTCGAGATCATCAACCTCGCCGGCGTAAACTCCATCAACAACGGCATCAGA
GCCGTCGACGGCCAGAACCAATGCGTCATCAATGGTGTCGTCATGGGTGTTCTTCAGGAACAGAGGGGGGAGAAG
GGCAAGGAGGCTCCTGCGGCCAAAACGATCCCTCTGTCCGATATTGGTCTCGGAAACGCTGCCACAACGACGAGA
TCGCAAACAACGGCAGCGACAACTCCCCATCACCCCTCCCCTCCGCCCCAACAACAACAACAACAGCAACAACAA
CAACAGCAACAACAACAACAGCAACAACCCCAACAACCCCAACAACAAAGACAACAACCTCCTCCCTCCGCCCCA
AGCCCAACCAAAAGCCGAACCCCCCCAGCCCAACCAGCCCAGTCAACAACCGCCGCCGCCGCAGCACCACCCCCT
GCCAACTCGGCCGCCGCCGACCCCAAAAACACGGTGCTGAAATCCGGGCTTGATTTGGGGGCTCTGGCGCCCGAG
TGA
Gene >Ophcf2|03308
ATGCATCGTCTCGAGGCCTGGATCGTCCTGGCGGCATACCTTGGTGTGCTGGTAAGCGACCCTCACAACACGGCG
TCGCGTTCTCTTGGCTGACTCTTGGATCAGGTCACTGGGCTCGCGTATGAAAGGCAAGAGCACAGTCTGTTTGCG
AGACATGGCGTCCGCGGGGGTCCCGCGAAAGTGGCGCAGGTCTTTTCCGCAAAGATGGGCAAGGCTCGCGGGATG
AGCAAGGACAACGCGAACAAGAATCAGAACTTGAACGACAACAATGCCAACAAAGATCAGGGCCTAAACAACAAC
AACAACAACTTCGACAACAACAACAACAACAACAACAACAACTTCAACGATAACAATAACAACAACGGAAACAAC
TTTAATAGCAACGCGAATAACGGCAACGGCAACAATGGCAATAATTTCAACAACAACAATGACAACTTCAACGGC
AACAATGGCAATGGGATCAACTTTAACAACGGTAACGGCAATGGCAATGGCAATGGAAACGACTTCAACAACGCC
GCCGTGACGCAGGCTGTCGGTGGAGTAAGAGCCGCAAGCTTCCATCATGTGAACGCATATGCTGACAAGACACAG
TCCAACCAGCAGACCGTCACGGTGACCGTTACTCAGACGACGACCGTGTTTGGCAATAATGTACGTGGCCAACGT
GTCTTGCTGTCTCAGAAGCGTGCTGACTGTTGAGAATTAGGCTGCCTCCGCTACCGGAGCATTCGGCCAGAGCAA
TGCCTTTGGGGCCAACAACGGCAACAACTTCAACAACGGGAACAATTTCAACAACGGAAATAACGGGAACCTCTT
CAACAGCGGCAACAGCGGCGGCCTGGGCAACCTAGGCAACGTCAATGGCAACAACTTCAATGCCAACAACAACCT
GGCAAACAGTGCCCCGGCCAAGACCATCATCATCACGGGAGCCAGCGTAAACGGCGGGAACGTCGCTAACGGCGC
CAGCCTCAACAACGTCGGCACAGGCGGCACAGGCGGCACCGTCATCGTCTCCAGCCAGAGGCAAACCGGCGGCAC
CTTGAACAACGTGGGCAGCGCAGGCAACAGCGCCGTCATCATATCCAGCCAGAAACAAAACAACGGCATAAACAC
CGTCGGTGGCACGGGCGGCACCGTCCTCGTATCCAGCCAGAAACAAGGCGTCGGCAGCAACGTCGGCCTCGTCAA
CGGCGTCGGCAGCAACCAAGGCAGCAACCAAGGCGTCGAGATCATCAACCTCGCCGGCGTAAACTCCATCAACAA
CGGCATCAGAGCCGTCGACGGCCAGAACCAATGCGTCATCAATGGTGTCGTCATGGGTGTTCTTCAGGAACAGAG
GGGGGAGAAGGGCAAGGAGGCTCCTGCGGCCAAAACGATCCCTCTGTCCGATATTGGTCTCGGAAACGCTGCCAC
AACGACGAGATCGCAAACAACGGCAGCGACAACTCCCCATCACCCCTCCCCTCCGCCCCAACAACAACAACAACA
GCAACAACAACAACAGCAACAACAACAACAGCAACAACCCCAACAACCCCAACAACAAAGACAACAACCTCCTCC
CTCCGCCCCAAGCCCAACCAAAAGCCGAACCCCCCCAGCCCAACCAGCCCAGTCAACAACCGCCGCCGCCGCAGC
ACCACCCCCTGCCAACTCGGCCGCCGCCGACCCCAAAAACACGGTGCTGAAATCCGGGCTTGATTTGGGGGCTCT
GGCGCCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail