Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03299
Gene name
Locationscaffold_03:2290492..2291508
Strand-
Gene length (bp)1016
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion|Endoplasmic reticulum|Lysosome/Vacuole Signal peptide 0.2829 0.1366 0.163 0.1103 0.6442 0.0187 0.6459 0.5678 0.5981 0.0617

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2027
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4669
Ophiocordyceps australis map64 (Brazil) OphauB2|4507
Ophiocordyceps camponoti-floridani Ophcf2|03299 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6175
Ophiocordyceps kimflemingae Ophio5|3538
Ophiocordyceps subramaniannii Hirsu2|2291

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03299
MLVLFQNVIIYNPFMPPNARSMRIADFARQCGGIQWREERIRSLDGTEIALCVSDMLPHETAHTRVYIIYFQGNA
SSLPPRLPDISWVLRRLKDQNKPISYTTVCLSYRGYWTSHDRPSERGINLDAQAALQWVARLHRDSPAKPVVLLW
GQSIGCGFATNLAAMSGSDTVIDALILETPFTNTRAMLKALYPQKWLPYQHLWPFLRNHLDSWKNLAVIAAKEQF
LLPAVYLVEAAKDELVPRDHAAALQRRCQDLGLAVRRISIAGALHNDVMVRKSGKQAIAESISEAVTEAVARPGS
EARIDAANEVR*
Coding >Ophcf2|03299
ATGCTGGTCCTCTTCCAGAATGTCATCATCTATAACCCTTTCATGCCGCCAAATGCCAGGAGCATGCGCATTGCA
GACTTTGCCCGTCAGTGTGGAGGCATTCAGTGGCGTGAGGAGCGCATCCGGTCTCTGGATGGGACGGAGATTGCC
TTGTGTGTCAGCGACATGTTGCCTCACGAAACTGCGCATACGAGAGTCTACATCATCTACTTTCAGGGCAACGCT
TCGTCGCTGCCACCTCGTCTTCCAGACATCTCCTGGGTTTTGCGCCGCCTGAAAGATCAGAACAAACCCATCAGC
TATACGACCGTCTGTCTAAGCTATCGCGGATACTGGACCTCGCACGACCGGCCCTCGGAACGCGGCATCAACTTG
GATGCCCAAGCCGCGTTGCAGTGGGTAGCGCGACTTCACCGAGACAGCCCTGCCAAGCCCGTGGTTCTTCTCTGG
GGCCAGAGCATTGGCTGCGGCTTTGCCACCAATCTGGCCGCCATGTCAGGTAGCGACACGGTCATTGACGCGCTG
ATATTGGAAACGCCATTCACAAACACCCGCGCCATGCTTAAGGCCCTCTACCCTCAAAAGTGGCTGCCCTATCAG
CATCTATGGCCCTTTCTCCGCAACCATCTCGACAGCTGGAAGAACTTGGCAGTAATAGCTGCCAAGGAGCAGTTC
CTTCTACCTGCTGTATACCTCGTCGAAGCGGCCAAGGACGAGCTTGTGCCCAGAGACCATGCCGCAGCTCTGCAG
CGGCGATGTCAGGATCTTGGCCTTGCCGTTAGAAGAATCTCTATTGCGGGAGCGCTCCATAACGACGTCATGGTG
CGCAAGAGCGGGAAACAGGCCATTGCAGAGTCCATCTCTGAGGCTGTGACAGAGGCCGTCGCTCGGCCAGGGTCG
GAAGCCAGGATAGATGCCGCCAACGAGGTGCGTTGA
Transcript >Ophcf2|03299
ATGCTGGTCCTCTTCCAGAATGTCATCATCTATAACCCTTTCATGCCGCCAAATGCCAGGAGCATGCGCATTGCA
GACTTTGCCCGTCAGTGTGGAGGCATTCAGTGGCGTGAGGAGCGCATCCGGTCTCTGGATGGGACGGAGATTGCC
TTGTGTGTCAGCGACATGTTGCCTCACGAAACTGCGCATACGAGAGTCTACATCATCTACTTTCAGGGCAACGCT
TCGTCGCTGCCACCTCGTCTTCCAGACATCTCCTGGGTTTTGCGCCGCCTGAAAGATCAGAACAAACCCATCAGC
TATACGACCGTCTGTCTAAGCTATCGCGGATACTGGACCTCGCACGACCGGCCCTCGGAACGCGGCATCAACTTG
GATGCCCAAGCCGCGTTGCAGTGGGTAGCGCGACTTCACCGAGACAGCCCTGCCAAGCCCGTGGTTCTTCTCTGG
GGCCAGAGCATTGGCTGCGGCTTTGCCACCAATCTGGCCGCCATGTCAGGTAGCGACACGGTCATTGACGCGCTG
ATATTGGAAACGCCATTCACAAACACCCGCGCCATGCTTAAGGCCCTCTACCCTCAAAAGTGGCTGCCCTATCAG
CATCTATGGCCCTTTCTCCGCAACCATCTCGACAGCTGGAAGAACTTGGCAGTAATAGCTGCCAAGGAGCAGTTC
CTTCTACCTGCTGTATACCTCGTCGAAGCGGCCAAGGACGAGCTTGTGCCCAGAGACCATGCCGCAGCTCTGCAG
CGGCGATGTCAGGATCTTGGCCTTGCCGTTAGAAGAATCTCTATTGCGGGAGCGCTCCATAACGACGTCATGGTG
CGCAAGAGCGGGAAACAGGCCATTGCAGAGTCCATCTCTGAGGCTGTGACAGAGGCCGTCGCTCGGCCAGGGTCG
GAAGCCAGGATAGATGCCGCCAACGAGGTGCGTTGA
Gene >Ophcf2|03299
ATGCTGGTCCTCTTCCAGAATGTCATCATCTATAACCCTTTCATGCCGCCAAATGCCAGGAGCATGCGCATTGCA
GACTTTGCCCGTCAGTGTGGAGGCATTCAGTGGCGTGAGGAGCGCATCCGGTCTCTGGATGGGACGGAGATTGCC
TTGTGTGTCAGCGACATGTTGCCTCACGAAACTGCGCATACGAGAGTCTACATCATCTACTTTCAGGGTGGGTTT
CCTGTCTCAGCGCATAACGTCCTCCGTTTTACTTCATCGATAGCAAAATATTGCCGCTTACAGCGCTCACAGGCA
ACGCTTCGTCGCTGCCACCTCGTCTTCCAGACATCTCCTGGGTTTTGCGCCGCCTGAAAGATCAGAACAAACCCA
TCAGCTATACGACCGTCTGTCTAAGCTATCGCGGATACTGGACCTCGCACGACCGGCCCTCGGAACGCGGCATCA
ACTTGGATGCCCAAGCCGCGTTGCAGTGGGTAGCGCGACTTCACCGAGACAGCCCTGCCAAGCCCGTGGTTCTTC
TCTGGGGCCAGAGCATTGGCTGCGGCTTTGCCACCAATCTGGCCGCCATGTCAGGTAGCGACACGGTCATTGACG
CGCTGATATTGGAAACGCCATTCACAAACACCCGCGCCATGCTTAAGGCCCTCTACCCTCAAAAGTGGCTGCCCT
ATCAGCATCTATGGCCCTTTCTCCGCAACCATCTCGACAGCTGGAAGAACTTGGCAGTAATAGCTGCCAAGGAGC
AGTTCCTTCTACCTGCTGTATACCTCGTCGAAGCGGCCAAGGACGAGCTTGTGCCCAGAGACCATGCCGCAGCTC
TGCAGCGGCGATGTCAGGATCTTGGCCTTGCCGTTAGAAGAATCTCTATTGCGGGAGCGCTCCATAACGACGTCA
TGGTGCGCAAGAGCGGGAAACAGGCCATTGCAGAGTCCATCTCTGAGGCTGTGACAGAGGCCGTCGCTCGGCCAG
GGTCGGAAGCCAGGATAGATGCCGCCAACGAGGTGCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail