Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03297
Gene name
Locationscaffold_03:2286340..2287998
Strand+
Gene length (bp)1658
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 1.2E-09 324 447

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.603 0.5781 0.1919 0.0474 0.1171 0.0041 0.0365 0.3855 0.2094 0.0046

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2025
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4667
Ophiocordyceps australis map64 (Brazil) OphauB2|4509
Ophiocordyceps camponoti-floridani Ophcf2|03297 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6177
Ophiocordyceps kimflemingae Ophio5|3540
Ophiocordyceps subramaniannii Hirsu2|2289

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03297
MNHLFDSFALAYDAKNGYSLAQTLTPVAPPDDPGLLVRIWNSTNAQNAKSDILHYVKKQAAYFKDLGHDEINGWV
EVYFAYWKALGVIVAGENGKSSWTDTYEAWKALCSVLIRGYNNCGFQAWTIPTLYLVGKYLRIFAIKSDEERART
GAVPAALVSYFQDDFDPEMQEQAQLRDCEQHLKRIFTLCLNDRAPLEESRKWGIYYIINLLFKTYFKLNSASLSM
TILKTLAVYNNKGDMPPLEKFPMGQRVTFRFYEGVLHFLEENYVQAEKSLFEAWQLCHKDAKANLERILTYLVPC
RMMTSHVLPSKELLEPYPLLQQIFLPLSQSIRRGDLGGFNKALQEAESELIRRRIYLTLERGHDIAFRNLLRKVY
LAGGYDEPKEGDTAPVRRTRIPIGEFVAAVRMSTGDETMVRERVELLMCNIIYKDLMKGYISRERGIVVLSKKGA
FPGTGV*
Coding >Ophcf2|03297
ATGAATCACCTCTTCGATTCGTTCGCACTCGCGTACGACGCCAAAAACGGCTATTCACTTGCGCAGACTCTCACT
CCAGTTGCGCCGCCTGATGACCCTGGCCTGCTCGTGAGAATCTGGAACAGCACAAACGCTCAGAACGCCAAGTCG
GACATCTTGCACTACGTCAAGAAGCAGGCAGCCTATTTCAAAGACCTTGGTCATGACGAAATCAACGGTTGGGTC
GAAGTTTATTTCGCTTACTGGAAAGCCCTCGGCGTGATTGTTGCTGGGGAGAATGGAAAGTCGTCGTGGACTGAT
ACTTACGAGGCCTGGAAAGCCCTTTGCTCTGTCTTGATCCGTGGTTATAACAACTGCGGATTCCAAGCCTGGACC
ATTCCCACCTTGTATTTGGTTGGCAAGTACCTGAGGATTTTCGCCATCAAGTCGGACGAGGAACGCGCTCGTACC
GGAGCTGTCCCAGCAGCCCTTGTCTCCTACTTTCAAGACGACTTCGACCCGGAGATGCAGGAGCAGGCGCAGCTC
AGGGACTGTGAGCAGCATCTCAAACGCATCTTTACGCTGTGCCTCAATGATAGAGCGCCTTTGGAAGAGTCTCGT
AAATGGGGGATCTACTACATCATCAATCTCCTCTTCAAGACTTACTTCAAACTCAACTCGGCATCCCTTTCCATG
ACCATTCTTAAGACTTTGGCCGTCTACAATAACAAGGGGGACATGCCTCCTCTGGAAAAATTTCCCATGGGCCAG
AGAGTGACGTTCAGATTCTACGAAGGTGTCCTCCATTTTCTCGAGGAGAACTATGTCCAGGCTGAAAAAAGTCTC
TTCGAGGCTTGGCAACTCTGCCACAAGGACGCCAAAGCAAACTTGGAGCGCATCTTGACGTATCTTGTCCCTTGC
AGAATGATGACGAGCCACGTCCTCCCATCGAAGGAGCTGCTGGAGCCGTATCCTCTTCTTCAGCAAATCTTTTTG
CCGCTTTCCCAGAGCATTAGACGCGGCGACCTGGGGGGCTTTAACAAGGCGCTCCAGGAGGCCGAGTCCGAACTC
ATCAGACGACGCATTTACTTGACGCTTGAGCGTGGTCACGACATTGCATTCCGCAACCTTTTGCGCAAAGTCTAC
CTCGCGGGGGGATACGACGAACCCAAGGAAGGGGATACAGCTCCAGTCCGTCGGACTCGCATTCCCATTGGCGAG
TTTGTGGCGGCCGTGCGCATGAGCACCGGCGACGAGACTATGGTCCGCGAGCGAGTGGAACTGCTCATGTGCAAC
ATAATTTACAAGGATCTCATGAAGGGCTACATTTCGCGCGAGCGAGGCATTGTCGTGCTGTCCAAGAAAGGTGCC
TTTCCCGGCACTGGAGTTTAA
Transcript >Ophcf2|03297
ATGAATCACCTCTTCGATTCGTTCGCACTCGCGTACGACGCCAAAAACGGCTATTCACTTGCGCAGACTCTCACT
CCAGTTGCGCCGCCTGATGACCCTGGCCTGCTCGTGAGAATCTGGAACAGCACAAACGCTCAGAACGCCAAGTCG
GACATCTTGCACTACGTCAAGAAGCAGGCAGCCTATTTCAAAGACCTTGGTCATGACGAAATCAACGGTTGGGTC
GAAGTTTATTTCGCTTACTGGAAAGCCCTCGGCGTGATTGTTGCTGGGGAGAATGGAAAGTCGTCGTGGACTGAT
ACTTACGAGGCCTGGAAAGCCCTTTGCTCTGTCTTGATCCGTGGTTATAACAACTGCGGATTCCAAGCCTGGACC
ATTCCCACCTTGTATTTGGTTGGCAAGTACCTGAGGATTTTCGCCATCAAGTCGGACGAGGAACGCGCTCGTACC
GGAGCTGTCCCAGCAGCCCTTGTCTCCTACTTTCAAGACGACTTCGACCCGGAGATGCAGGAGCAGGCGCAGCTC
AGGGACTGTGAGCAGCATCTCAAACGCATCTTTACGCTGTGCCTCAATGATAGAGCGCCTTTGGAAGAGTCTCGT
AAATGGGGGATCTACTACATCATCAATCTCCTCTTCAAGACTTACTTCAAACTCAACTCGGCATCCCTTTCCATG
ACCATTCTTAAGACTTTGGCCGTCTACAATAACAAGGGGGACATGCCTCCTCTGGAAAAATTTCCCATGGGCCAG
AGAGTGACGTTCAGATTCTACGAAGGTGTCCTCCATTTTCTCGAGGAGAACTATGTCCAGGCTGAAAAAAGTCTC
TTCGAGGCTTGGCAACTCTGCCACAAGGACGCCAAAGCAAACTTGGAGCGCATCTTGACGTATCTTGTCCCTTGC
AGAATGATGACGAGCCACGTCCTCCCATCGAAGGAGCTGCTGGAGCCGTATCCTCTTCTTCAGCAAATCTTTTTG
CCGCTTTCCCAGAGCATTAGACGCGGCGACCTGGGGGGCTTTAACAAGGCGCTCCAGGAGGCCGAGTCCGAACTC
ATCAGACGACGCATTTACTTGACGCTTGAGCGTGGTCACGACATTGCATTCCGCAACCTTTTGCGCAAAGTCTAC
CTCGCGGGGGGATACGACGAACCCAAGGAAGGGGATACAGCTCCAGTCCGTCGGACTCGCATTCCCATTGGCGAG
TTTGTGGCGGCCGTGCGCATGAGCACCGGCGACGAGACTATGGTCCGCGAGCGAGTGGAACTGCTCATGTGCAAC
ATAATTTACAAGGATCTCATGAAGGGCTACATTTCGCGCGAGCGAGGCATTGTCGTGCTGTCCAAGAAAGGTGCC
TTTCCCGGCACTGGAGTTTAA
Gene >Ophcf2|03297
ATGAATCACCTCTTCGATTCGTTCGCACTCGCGTACGACGCCAAAAACGGCTATTCACTTGCGCAGACTCTCACT
CCAGTTGCGCCGCCTGATGACCCTGGCCTGCTCGTGAGAATCTGGAACAGCACAAACGCTCAGAACGCCAAGTCG
GACATCTTGCACTACGTCAAGAAGCAGGCAGCCTATTTCAAAGACCTTGGTCATGACGAAATCAACGGTTGGGTC
GAAGTTTATTTCGCTTACTGGAAAGCCCTCGGCGTGATTGTTGCTGGGGAGAATGGAAAGGTCAGCTACAGCGAC
GTCAGGCTCATCGACAGATTCGCCGAAATGAAGCTGACCGAAGACGCTCAGTCGTCGTGGACTGATACTTACGAG
GCCTGGAAAGCCCTTTGCTCTGTCTTGATCCGTGGTTATAACAACTGCGGATTCCAAGCCTGGACCATTCCCACC
TTGTATTTGGTTGGCAAGTACCTGAGGATTTTCGCCATCAAGTCGGACGAGGAACGCGCTCGTACCGGAGCTGTC
CCAGCAGCCCTTGTCTCCTACTTTCAAGACGACTTCGACCCGGAGATGCAGGAGCAGGCGCAGCTCAGGGACTGT
GAGCAGCATCTCAAACGCATCTTTACGCTGTGCCTCAATGATAGGTAAGCTACTATTCCGCCGAAAACATCGACC
CAGCTGACCATGGAATTCAGAGCGCCTTTGGAAGAGTCTCGTAAATGGGGGATCTACTACATCATCAATCTCCTC
TTCAAGACTTACTTCAAACTCAACTCGGCATCCCTTTCCATGACCATTCTTAAGACTTTGGCCGTCTACAATAAC
AAGGGGGACATGCCTCCTCTGGAAAAATTTCCCATGGGCCAGAGAGTGACGTTCAGATTCTACGAAGGTGTCCTC
CATTTTCTCGAGGAGAACTATGTCCAGGTATGCACCTCTTCTCCCGCTTTATTGAAGGGCTGTAATCGCTAATGC
CGTCACTTAGGCTGAAAAAAGTCTCTTCGAGGCTTGGCAACTCTGCCACAAGGACGCCAAAGCAAACTTGGAGTA
AGTTTGACCCAAGAGATGATGTTGAAAAGATTCGTTGCTGACAGTATTCCAGGCGCATCTTGACGTATCTTGTCC
CTTGCAGAATGATGACGAGCCACGTCCTCCCATCGAAGGAGCTGCTGGAGCCGTATCCTCTTCTTCAGCAAATCT
TTTTGCCGCTTTCCCAGAGCATTAGACGCGGCGACCTGGGGGGCTTTAACAAGGCGCTCCAGGAGGCCGAGTCCG
AACTCATCAGACGACGCATTTACTTGACGCTTGAGCGTGGTCACGACATTGCATTCCGCAACCTTTTGCGCAAAG
TCTACCTCGCGGGGGGATACGACGAACCCAAGGAAGGGGATACAGCTCCAGTCCGTCGGACTCGCATTCCCATTG
GCGAGTTTGTGGCGGCCGTGCGCATGAGCACCGGCGACGAGACTATGGTCCGCGAGCGAGTGGAACTGCTCATGT
GCAACATAATTTACAAGGTAAGAAGAGAGTCTTACTTCATCGGTTGTCGGTTACTGACGAGCGACGCCATTCAGG
ATCTCATGAAGGGCTACATTTCGCGCGAGCGAGGCATTGTCGTGCTGTCCAAGAAAGGTGCCTTTCCCGGCACTG
GAGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail