Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03295
Gene name
Locationscaffold_03:2281899..2282448
Strand+
Gene length (bp)549
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0956 0.1073 0.9012 0.0802 0.1156 0.0148 0.1603 0.1285 0.0692 0.0044

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999673

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup569
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2676
Ophiocordyceps australis 1348a (Ghana) OphauG2|6197
Ophiocordyceps australis map64 (Brazil) OphauB2|4006
Ophiocordyceps camponoti-floridani Ophcf2|03295 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7314
Ophiocordyceps kimflemingae Ophio5|3542
Ophiocordyceps subramaniannii Hirsu2|5316
Ophiocordyceps subramaniannii Hirsu2|8001

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03295
MQTPRLSHLLTALLCATTSQAKPPHTSTCYEGEGSNLHCYNGKDDTPQGVNVADVAEAAQALRAYGREENPGRFL
TMTAANAPDCAEWTIYELRSVLVLAKHVGSDKNSSVLFEDVARTIADEPGHGDDQKPILSCLAAGGSLGVRVNGS
SPAYKSDEYKKSGFSPEGIIVKIVSNGRKVDL*
Coding >Ophcf2|03295
ATGCAAACCCCACGACTATCACACCTCCTCACAGCCCTCCTCTGCGCAACAACCTCCCAAGCCAAACCCCCCCAC
ACCTCAACCTGCTACGAAGGCGAAGGCTCTAACCTCCACTGCTACAACGGCAAAGACGACACGCCGCAGGGCGTC
AACGTAGCCGACGTCGCCGAAGCCGCTCAGGCCCTTCGCGCCTATGGCCGTGAGGAAAACCCCGGCCGCTTCCTC
ACCATGACGGCTGCCAATGCGCCCGACTGCGCGGAGTGGACCATTTATGAGCTTCGCTCTGTCCTCGTCCTGGCT
AAGCATGTTGGCTCGGACAAGAACTCGTCTGTTCTGTTCGAGGATGTGGCCAGGACCATTGCCGATGAGCCTGGT
CATGGTGATGATCAGAAACCCATCCTCAGCTGTCTGGCTGCCGGTGGCTCACTCGGCGTCCGGGTCAACGGGTCC
AGTCCTGCGTACAAGTCGGACGAGTATAAGAAATCGGGCTTCTCGCCGGAAGGCATCATCGTCAAGATCGTCTCT
AATGGACGCAAGGTAGATCTTTGA
Transcript >Ophcf2|03295
ATGCAAACCCCACGACTATCACACCTCCTCACAGCCCTCCTCTGCGCAACAACCTCCCAAGCCAAACCCCCCCAC
ACCTCAACCTGCTACGAAGGCGAAGGCTCTAACCTCCACTGCTACAACGGCAAAGACGACACGCCGCAGGGCGTC
AACGTAGCCGACGTCGCCGAAGCCGCTCAGGCCCTTCGCGCCTATGGCCGTGAGGAAAACCCCGGCCGCTTCCTC
ACCATGACGGCTGCCAATGCGCCCGACTGCGCGGAGTGGACCATTTATGAGCTTCGCTCTGTCCTCGTCCTGGCT
AAGCATGTTGGCTCGGACAAGAACTCGTCTGTTCTGTTCGAGGATGTGGCCAGGACCATTGCCGATGAGCCTGGT
CATGGTGATGATCAGAAACCCATCCTCAGCTGTCTGGCTGCCGGTGGCTCACTCGGCGTCCGGGTCAACGGGTCC
AGTCCTGCGTACAAGTCGGACGAGTATAAGAAATCGGGCTTCTCGCCGGAAGGCATCATCGTCAAGATCGTCTCT
AATGGACGCAAGGTAGATCTTTGA
Gene >Ophcf2|03295
ATGCAAACCCCACGACTATCACACCTCCTCACAGCCCTCCTCTGCGCAACAACCTCCCAAGCCAAACCCCCCCAC
ACCTCAACCTGCTACGAAGGCGAAGGCTCTAACCTCCACTGCTACAACGGCAAAGACGACACGCCGCAGGGCGTC
AACGTAGCCGACGTCGCCGAAGCCGCTCAGGCCCTTCGCGCCTATGGCCGTGAGGAAAACCCCGGCCGCTTCCTC
ACCATGACGGCTGCCAATGCGCCCGACTGCGCGGAGTGGACCATTTATGAGCTTCGCTCTGTCCTCGTCCTGGCT
AAGCATGTTGGCTCGGACAAGAACTCGTCTGTTCTGTTCGAGGATGTGGCCAGGACCATTGCCGATGAGCCTGGT
CATGGTGATGATCAGAAACCCATCCTCAGCTGTCTGGCTGCCGGTGGCTCACTCGGCGTCCGGGTCAACGGGTCC
AGTCCTGCGTACAAGTCGGACGAGTATAAGAAATCGGGCTTCTCGCCGGAAGGCATCATCGTCAAGATCGTCTCT
AATGGACGCAAGGTAGATCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail