Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03284
Gene name
Locationscaffold_03:2159459..2161254
Strand-
Gene length (bp)1795
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 5.6E-112 40 489
PF07690 MFS_1 Major Facilitator Superfamily 3.8E-16 84 239
PF07690 MFS_1 Major Facilitator Superfamily 2.9E-09 309 479

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 87 109 22
3 116 138 22
4 174 196 22
5 203 225 22
6 360 377 17
7 390 412 22
8 427 449 22
9 456 475 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 20.76 10.37 31.16
Alive In ants, during behavior modification 24.77 12.80 36.75
Dead In ants, recently dead 34.06 18.74 49.38

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.464107 no
Alive Dead 0.067963 no
Dead Fungus 0.013485 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03284
MASSRSSSSRSNRNRSRYLLGLRGDGLNWAIGAVAGCDFLLFGYDQGVMGGILTLPVFLTQFPDINDKDPAIAHS
HELQSRRSTNQGIAVASYNLGCFAGAVLTIFVGNPLGRRRVIFLGTALMIFGAALQASASSLTHFIAGRVITGLG
NGANTSTVPMWQSETCAPHKRGRFVMIEGALITGGIMISYWVDLGLSFASGSIAWRFPLAFQVVFCVFILALVLT
LPESPRWLVLKDRDDEARHAIAAVAAVDEHDAYVDNELLAIRATLDELSKGTYAELFALDKKRTLHRTVLAYMNQ
MFQQISGINLITYYAAKIYSDLGMSPFLSRLLAALNGTEYFIASWPAVCLIERVGRRKLMIFGAAGQAATMAVLA
GVNSRPQDKACQVAAIVFLFVFNTFFAVGWLGMTWLYPAEITPLRTRAPANALSTSSNWIFNFLVVMITPIAFQN
IQYKTYVVFAVINAFMVPFVYFFFPETAYRSLEEMDTIFEKVSGWRGVLDVVEQARIEPRRYGKKGELLLVVDDA
GEDVGAGKISDGSGDKPVLATVSPLLLEKKTERTG*
Coding >Ophcf2|03284
ATGGCCAGCAGCAGAAGCAGCAGCAGCAGAAGCAATAGGAACAGAAGCAGATATCTACTTGGCCTTCGAGGTGAT
GGCCTCAACTGGGCCATCGGTGCCGTCGCCGGCTGTGATTTCCTCCTCTTCGGATACGACCAGGGCGTCATGGGA
GGAATCCTGACCCTCCCCGTCTTCCTCACCCAATTCCCCGACATAAACGACAAAGACCCAGCCATAGCCCACAGC
CACGAGCTACAATCCCGCCGATCAACGAACCAAGGCATCGCCGTGGCGTCGTACAACCTGGGCTGCTTCGCCGGC
GCCGTCCTTACAATCTTCGTCGGTAACCCCCTCGGTCGACGGCGCGTCATCTTCCTCGGCACCGCGCTCATGATC
TTCGGCGCGGCTCTGCAGGCGTCGGCCTCGTCTCTGACGCACTTTATCGCCGGGCGTGTCATTACGGGGTTGGGG
AATGGGGCGAATACTTCGACGGTTCCTATGTGGCAGTCTGAGACTTGCGCGCCGCACAAGCGCGGCAGGTTTGTC
ATGATTGAAGGCGCTCTTATTACGGGGGGCATCATGATCTCTTACTGGGTTGACCTTGGTCTTTCGTTCGCTTCG
GGTTCCATTGCTTGGCGGTTTCCGCTCGCCTTTCAGGTCGTCTTCTGCGTCTTCATTCTTGCTCTGGTCTTGACT
CTGCCTGAGTCTCCGCGCTGGCTTGTCCTCAAAGACCGAGACGATGAGGCTCGCCATGCCATTGCCGCCGTCGCC
GCCGTTGATGAGCATGATGCTTATGTCGACAATGAGCTGCTTGCCATTCGGGCTACCCTCGATGAGTTGAGCAAG
GGAACCTATGCCGAGCTGTTCGCCCTCGATAAGAAGCGTACTCTTCACCGCACCGTCCTTGCCTACATGAACCAG
ATGTTCCAGCAGATATCCGGCATCAATCTCATCACATACTACGCCGCCAAGATCTACTCGGACCTCGGCATGTCT
CCTTTCCTATCCCGGCTGCTGGCCGCTCTCAACGGAACAGAGTACTTCATCGCCTCCTGGCCCGCCGTGTGTCTC
ATCGAGCGCGTCGGCCGTCGCAAGCTCATGATCTTCGGCGCTGCTGGCCAGGCCGCCACTATGGCTGTCTTGGCC
GGCGTCAACTCGAGACCTCAAGACAAGGCCTGCCAGGTCGCTGCCATTGTCTTTCTCTTCGTCTTCAACACCTTT
TTCGCTGTCGGCTGGCTTGGTATGACGTGGCTCTATCCGGCGGAGATTACGCCGCTGCGTACTCGAGCCCCTGCA
AACGCCTTGTCGACGTCTTCCAACTGGATCTTCAATTTTCTGGTCGTCATGATCACGCCCATTGCCTTTCAGAAT
ATCCAGTACAAGACATACGTCGTATTCGCCGTCATCAACGCCTTCATGGTACCGTTCGTCTACTTCTTCTTCCCG
GAGACGGCATACCGATCACTGGAAGAAATGGACACCATCTTCGAAAAGGTCTCAGGCTGGCGAGGCGTCTTGGAC
GTGGTCGAGCAGGCGAGAATCGAGCCGCGTCGGTACGGTAAGAAGGGAGAATTGCTCCTTGTCGTGGACGATGCT
GGCGAGGACGTAGGAGCTGGGAAGATTAGCGATGGCTCTGGTGATAAGCCTGTGCTTGCCACCGTCTCGCCATTG
CTGCTTGAGAAGAAGACGGAAAGGACAGGATAA
Transcript >Ophcf2|03284
ATGGCCAGCAGCAGAAGCAGCAGCAGCAGAAGCAATAGGAACAGAAGCAGATATCTACTTGGCCTTCGAGGTGAT
GGCCTCAACTGGGCCATCGGTGCCGTCGCCGGCTGTGATTTCCTCCTCTTCGGATACGACCAGGGCGTCATGGGA
GGAATCCTGACCCTCCCCGTCTTCCTCACCCAATTCCCCGACATAAACGACAAAGACCCAGCCATAGCCCACAGC
CACGAGCTACAATCCCGCCGATCAACGAACCAAGGCATCGCCGTGGCGTCGTACAACCTGGGCTGCTTCGCCGGC
GCCGTCCTTACAATCTTCGTCGGTAACCCCCTCGGTCGACGGCGCGTCATCTTCCTCGGCACCGCGCTCATGATC
TTCGGCGCGGCTCTGCAGGCGTCGGCCTCGTCTCTGACGCACTTTATCGCCGGGCGTGTCATTACGGGGTTGGGG
AATGGGGCGAATACTTCGACGGTTCCTATGTGGCAGTCTGAGACTTGCGCGCCGCACAAGCGCGGCAGGTTTGTC
ATGATTGAAGGCGCTCTTATTACGGGGGGCATCATGATCTCTTACTGGGTTGACCTTGGTCTTTCGTTCGCTTCG
GGTTCCATTGCTTGGCGGTTTCCGCTCGCCTTTCAGGTCGTCTTCTGCGTCTTCATTCTTGCTCTGGTCTTGACT
CTGCCTGAGTCTCCGCGCTGGCTTGTCCTCAAAGACCGAGACGATGAGGCTCGCCATGCCATTGCCGCCGTCGCC
GCCGTTGATGAGCATGATGCTTATGTCGACAATGAGCTGCTTGCCATTCGGGCTACCCTCGATGAGTTGAGCAAG
GGAACCTATGCCGAGCTGTTCGCCCTCGATAAGAAGCGTACTCTTCACCGCACCGTCCTTGCCTACATGAACCAG
ATGTTCCAGCAGATATCCGGCATCAATCTCATCACATACTACGCCGCCAAGATCTACTCGGACCTCGGCATGTCT
CCTTTCCTATCCCGGCTGCTGGCCGCTCTCAACGGAACAGAGTACTTCATCGCCTCCTGGCCCGCCGTGTGTCTC
ATCGAGCGCGTCGGCCGTCGCAAGCTCATGATCTTCGGCGCTGCTGGCCAGGCCGCCACTATGGCTGTCTTGGCC
GGCGTCAACTCGAGACCTCAAGACAAGGCCTGCCAGGTCGCTGCCATTGTCTTTCTCTTCGTCTTCAACACCTTT
TTCGCTGTCGGCTGGCTTGGTATGACGTGGCTCTATCCGGCGGAGATTACGCCGCTGCGTACTCGAGCCCCTGCA
AACGCCTTGTCGACGTCTTCCAACTGGATCTTCAATTTTCTGGTCGTCATGATCACGCCCATTGCCTTTCAGAAT
ATCCAGTACAAGACATACGTCGTATTCGCCGTCATCAACGCCTTCATGGTACCGTTCGTCTACTTCTTCTTCCCG
GAGACGGCATACCGATCACTGGAAGAAATGGACACCATCTTCGAAAAGGTCTCAGGCTGGCGAGGCGTCTTGGAC
GTGGTCGAGCAGGCGAGAATCGAGCCGCGTCGGTACGGTAAGAAGGGAGAATTGCTCCTTGTCGTGGACGATGCT
GGCGAGGACGTAGGAGCTGGGAAGATTAGCGATGGCTCTGGTGATAAGCCTGTGCTTGCCACCGTCTCGCCATTG
CTGCTTGAGAAGAAGACGGAAAGGACAGGATAA
Gene >Ophcf2|03284
ATGGCCAGCAGCAGAAGCAGCAGCAGCAGAAGCAATAGGAACAGAAGCAGATATCTACTTGGCCTTCGAGGTGAT
GGCCTCAACTGGGCCATCGGTGCCGTCGCCGGCTGTGATTTCCTCCTCTTCGGATACGGTAGCCATCCTCCAAAA
CAAGATACTGATCAAAACGACTCACGATCGCAAGACCAGGGCGTCATGGGAGGAATCCTGACCCTCCCCGTCTTC
CTCACCCAATTCCCCGACATAAACGACAAAGACCCAGCCATAGCCCACAGCCACGAGCTACAATCCCGCCGATCA
ACGAACCAAGGCATCGCCGTGGCGTCGTACAACCTGGGCTGCTTCGCCGGCGCCGTCCTTACAATCTTCGTCGGT
AACCCCCTCGGTCGACGGCGCGTCATCTTCCTCGGCACCGCGCTCATGATCTTCGGCGCGGCTCTGCAGGCGTCG
GCCTCGTCTCTGACGCACTTTATCGCCGGGCGTGTCATTACGGGGTTGGGGAATGGGGCGAATACTTCGACGGTT
CCTATGTGGCAGTCTGAGACTTGCGCGCCGCACAAGCGCGGCAGGTTTGTCATGATTGAAGGCGCTCTTATTACG
GGGGGCATCATGATCTCTTACTGGGTTGACCTTGGTCTTTCGTTCGCTTCGGGTTCCATTGCTTGGCGGTTTCCG
CTCGCCTTTCAGGTCGTCTTCTGCGTCTTCATTCTTGCTCTGGTCTTGACTCTGCCTGAGTCTCCGCGCTGGCTT
GTCCTCAAAGACCGAGACGATGAGGCTCGCCATGCCATTGCCGCCGTCGCCGCCGTTGATGAGCATGATGCTTAT
GTCGACAATGAGCTGCTTGCCATTCGGGCTACCCTCGATGAGTTGAGCAAGGGAACCTATGCCGAGCTGTTCGCC
CTCGATAAGAAGCGTACTCTTCACCGCACCGTCCTTGCCTACATGAACCAGATGTTCCAGCAGATATCCGGCATC
AATCTCATCACATACTACGCCGCCAAGATCTACTCGGACCTCGGCATGTCTCCTTTCCTATCCCGGCTGCTGGCC
GCTCTCAACGGAACAGAGTACTTCATCGCCTCCTGGCCCGCCGTGTGTCTCATCGAGCGCGTCGGCCGTCGCAAG
CTCATGATCTTCGGCGCTGCTGGCCAGGCCGCCACTATGGCTGTCTTGGCCGGCGTCAACTCGAGACCTCAAGAC
AAGGCCTGCCAGGTCGCTGCCATTGTCTTTCTCTTCGTCTTCAACACCTTTTTCGCTGTCGGCTGGCTTGGTATG
ACGTGGCTCTATCCGGCGGAGATTACGCCGCTGCGTACTCGAGCCCCTGCAAACGCCTTGTCGACGTCTTCCAAC
TGGATCTTCAATTTTCTGGTTAGTCGGAAGAGTGTGAGTTTCGTCTGCGTGACAGCTGACGAATAGGAACATGAA
AAAGGTCGTCATGATCACGCCCATTGCCTTTCAGAATATCCAGTACAAGACATACGTCGTATTCGCCGTCATCAA
CGCCTTCATGGTACCGTTCGTCTACTTCTTCTTCCCGGAGACGGCATACCGATCACTGGAAGAAATGGACACCAT
CTTCGAAAAGGTCTCAGGCTGGCGAGGCGTCTTGGACGTGGTCGAGCAGGCGAGAATCGAGCCGCGTCGGTACGG
TAAGAAGGGAGAATTGCTCCTTGTCGTGGACGATGCTGGCGAGGACGTAGGAGCTGGGAAGATTAGCGATGGCTC
TGGTGATAAGCCTGTGCTTGCCACCGTCTCGCCATTGCTGCTTGAGAAGAAGACGGAAAGGACAGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail