Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03276
Gene name
Locationscaffold_03:2098324..2102055
Strand+
Gene length (bp)3731
Transcript length (bp)3615
Coding sequence length (bp)3615
Protein length (aa) 1205

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00063 Myosin_head Myosin head (motor domain) 2.8E-239 45 703
PF06017 Myosin_TH1 Unconventional myosin tail, actin- and lipid-binding 7.1E-51 761 956
PF00018 SH3_1 SH3 domain 9.5E-12 1063 1108
PF14604 SH3_9 Variant SH3 domain 1.1E-07 1064 1112
PF07653 SH3_2 Variant SH3 domain 9.7E-08 1062 1114

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0003774 cytoskeletal motor activity Yes
GO:0016459 myosin complex Yes
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7123 0.1874 0.1857 0.3855 0.1067 0.0139 0.0798 0.0839 0.0922 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5882
Ophiocordyceps australis map64 (Brazil) OphauB2|1965
Ophiocordyceps camponoti-floridani Ophcf2|03276 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7301
Ophiocordyceps kimflemingae Ophio5|8077
Ophiocordyceps subramaniannii Hirsu2|7236

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03276
MGISRRPKNKTAADGQAAASGGRGGGAKPKKATFDVAKKKEVGVSDLTLLSKVSNEAINENLKKRFEGAEIYTYI
GHVLVSVNPFRDLGIYTEKVLDSYKGKNRLEMPPHVFAIAESAYYNMKAYKDNQCVIISGESGAGKTEAAKRIMQ
YIASVSGEQSGDIKKIKEMVLATNPLLESFGNAKTLRNNNSSRFGKYLQIHFNSTGEPVGADITNYLLEKTRVVG
QITNERNFHIFYQFTKGAPKQYQELYGIQRPETYVYTSRSKCFEVDGIDDVAEFQDTLKSMNTIGLSQSEQDEIF
RMLAAVLWIGNIQFQEDENGYAAVADQSVVEFVAYLLEVSPQQVINAITIRILTPRNGEVIESPGNPAQASATRD
ALAKAVYNNLFDWIVERINKSLKSRQATTNTIGILDIYGFEIFDKNSFEQLCINYVNEKLQQIFIQLTLKTEQEE
YANEKIKWTPIKYFDNKVVCDLIEQIRPPGIFSAMKDATKTAHADPAACDRTFMQSINGMSHAHLTPRQGNFIIK
HYAGDVSYTVDGITDKNKDQLLKGLLNLFQQSGNQLIHTLFPNQVDQDNRKQPPSAGDRIRASANALVDTLMKCQ
PSYIRTIKPNENKSPSEYNSSNVLHQVKYLGLQENVRIRRAGFAYRQAFDKFVDRFFLLSPATSYAGEYTWNGSY
ENAVKQILKDTSITKDEWQLGVTKAFVKSPETLFALEHMRDRYWHNMATRIQRMWRAYLAYRAESATRIQRMWRK
KRTGAEFLQLRDKGHRLYQGSKERRRMSLLGSRRFLGDYLGVNAATGYGAHVRKAAGIDSNERAVFSCRGEILEA
KFGRSSKPSPRTIVVTKSKFYIVVQLLVDGQPQTSLERAIPLSSIQYIGVSTCQDDWFSLGVGSTQDPDPLLNCV
FKTELFTQMQRVRTGGLDLKIAPAIEYAKKPGKPQQVKVLKDSQQHADYYKSGAIHTTQGEPPTSGSRPLPKGKP
KPPRPITRGKLIKPGGPGGRQTRPMGGRTAQPRPGADPARAAAVPPTAIGAPAATKAVASANKTGGANRDPPPPP
PAAPSSRSKVMAKVLYDFASQRENELSIHVGDIVEIVQKESNGWWLAKNAQGQAWVPAAYVEEQAAPAQPPVAAP
KPPPPPPSAKAKRTVPTPPAKRPTTGRKPGDLGQRDSGMSLNGANSAEGSRSSTPTPSLGGSLADALLARKNALQ
KGGQ*
Coding >Ophcf2|03276
ATGGGTATATCGCGACGTCCCAAAAACAAGACTGCCGCCGATGGGCAGGCGGCTGCTTCGGGCGGCCGAGGCGGC
GGCGCGAAACCCAAAAAGGCCACGTTCGACGTGGCGAAGAAGAAGGAGGTTGGTGTATCTGACCTGACTCTGTTG
AGCAAAGTGTCCAATGAGGCCATCAACGAAAACCTGAAGAAGCGTTTTGAGGGCGCCGAGATCTACACTTACATC
GGCCATGTGCTCGTCTCCGTCAATCCCTTCCGAGACCTCGGTATCTACACTGAGAAGGTCCTGGATAGTTACAAA
GGCAAAAACCGGCTCGAGATGCCGCCTCATGTCTTTGCCATTGCTGAGTCCGCCTACTACAATATGAAGGCCTAC
AAAGACAACCAGTGCGTCATCATCTCGGGTGAGTCGGGGGCGGGCAAGACTGAAGCTGCCAAGCGCATCATGCAA
TATATTGCCAGCGTTTCGGGCGAGCAGTCTGGCGATATCAAAAAGATCAAAGAAATGGTACTGGCCACGAATCCG
CTGCTCGAGTCATTCGGAAATGCAAAGACTTTACGAAATAATAACTCGTCTCGGTTTGGCAAATACCTTCAGATA
CACTTCAACTCGACGGGCGAGCCTGTCGGAGCCGACATCACTAACTACCTTCTGGAAAAGACGCGTGTTGTTGGC
CAAATAACGAACGAGAGAAATTTTCACATTTTCTACCAGTTCACCAAGGGCGCGCCCAAGCAGTACCAGGAGCTC
TATGGAATCCAAAGACCAGAAACCTACGTCTACACCAGTCGCTCCAAGTGCTTTGAGGTCGATGGCATCGATGAC
GTCGCCGAATTTCAAGATACCCTCAAGTCCATGAACACAATTGGGTTGAGTCAATCAGAGCAAGACGAGATCTTT
CGCATGTTGGCTGCGGTCCTTTGGATAGGTAATATCCAGTTTCAAGAGGACGAAAACGGCTACGCGGCTGTCGCC
GACCAGTCGGTAGTTGAGTTTGTGGCCTACCTCCTGGAAGTCTCGCCGCAGCAGGTGATCAACGCCATCACGATC
CGCATTTTGACCCCTCGCAACGGCGAAGTCATCGAGTCGCCCGGGAATCCCGCTCAGGCCTCGGCGACACGAGAT
GCCTTGGCCAAGGCCGTCTACAATAATCTCTTCGACTGGATTGTGGAACGCATCAACAAATCCCTCAAATCTCGG
CAAGCAACCACCAACACTATCGGCATCCTGGACATTTACGGCTTCGAGATTTTCGATAAGAACAGCTTCGAGCAA
CTGTGCATCAACTATGTCAACGAGAAGCTGCAACAGATCTTCATCCAGCTCACTCTGAAAACAGAACAGGAAGAG
TACGCCAATGAGAAGATCAAATGGACGCCCATAAAATACTTCGACAACAAGGTAGTGTGCGACCTGATTGAGCAG
ATCAGGCCCCCCGGCATCTTCTCCGCCATGAAGGATGCCACCAAGACGGCTCATGCCGATCCTGCCGCTTGCGAC
CGGACCTTTATGCAGAGCATCAACGGCATGTCTCACGCACATCTGACTCCGCGTCAGGGCAACTTCATCATCAAG
CACTACGCTGGTGACGTCTCCTACACAGTCGACGGTATCACGGACAAGAACAAGGATCAGCTCCTCAAGGGCCTT
CTGAATCTCTTTCAACAGAGCGGGAACCAATTAATTCATACCCTGTTTCCCAATCAGGTCGATCAAGACAATCGA
AAACAGCCACCCTCGGCCGGCGACCGAATCCGTGCTTCGGCGAATGCTCTTGTGGATACACTCATGAAATGTCAG
CCCTCGTACATCCGTACCATCAAGCCCAACGAGAACAAGTCTCCCTCCGAGTACAATAGCTCCAACGTACTGCAT
CAGGTCAAGTACCTGGGTCTTCAAGAGAACGTTCGCATCCGTCGGGCCGGGTTCGCCTACCGGCAAGCCTTTGAT
AAGTTTGTCGACCGCTTCTTCCTCTTGTCTCCCGCCACCTCGTACGCGGGCGAGTACACCTGGAACGGCTCTTAT
GAAAATGCTGTTAAGCAGATCCTCAAAGACACAAGCATTACAAAGGATGAGTGGCAGCTCGGAGTTACGAAGGCA
TTTGTCAAGTCACCAGAGACATTGTTTGCCTTGGAGCACATGAGAGATCGATACTGGCATAACATGGCGACTCGC
ATCCAGCGAATGTGGCGCGCATACCTCGCATACCGAGCCGAATCGGCGACACGCATACAACGCATGTGGAGGAAG
AAGCGAACTGGTGCCGAGTTCTTGCAACTCCGAGACAAGGGTCATCGTCTCTACCAGGGGAGCAAAGAAAGAAGG
CGGATGAGTCTTCTGGGCTCCCGGAGGTTTCTGGGCGATTACTTGGGCGTCAACGCTGCTACCGGCTACGGCGCA
CATGTCCGCAAGGCTGCTGGTATCGACTCTAACGAGCGCGCTGTGTTCTCCTGTCGAGGCGAGATACTGGAGGCC
AAGTTCGGACGATCTAGCAAGCCGAGCCCTCGCACCATCGTCGTCACTAAGAGCAAGTTTTACATCGTTGTGCAA
TTGCTGGTGGACGGTCAGCCGCAGACTTCATTAGAGCGGGCCATTCCCCTCAGCTCCATCCAGTACATTGGGGTT
TCTACGTGCCAGGACGACTGGTTCTCCCTTGGAGTCGGGTCTACTCAGGATCCCGATCCTTTGCTGAATTGCGTC
TTCAAAACCGAACTCTTTACACAGATGCAACGTGTTAGAACCGGCGGTCTCGATCTCAAGATTGCCCCTGCCATA
GAGTATGCTAAGAAACCCGGTAAACCACAGCAAGTCAAGGTCTTGAAAGACTCCCAGCAGCATGCCGACTACTAC
AAGAGTGGCGCTATACACACCACTCAAGGAGAACCTCCAACTTCCGGTTCGAGGCCTTTGCCCAAGGGCAAACCA
AAGCCGCCGCGACCCATCACCAGAGGCAAGCTGATCAAGCCGGGAGGACCGGGCGGCCGGCAGACTAGACCGATG
GGCGGCCGAACTGCACAGCCCAGGCCAGGAGCTGACCCTGCAAGGGCCGCGGCTGTCCCGCCTACGGCGATTGGC
GCACCGGCTGCAACCAAAGCTGTTGCTTCGGCGAACAAAACAGGCGGGGCCAACCGCGATCCGCCCCCCCCGCCA
CCGGCAGCTCCATCCTCTCGCTCCAAAGTCATGGCCAAGGTGTTATATGACTTCGCTAGTCAAAGAGAAAACGAG
CTCTCAATTCATGTGGGGGATATTGTCGAAATTGTACAGAAAGAAAGCAACGGCTGGTGGCTAGCGAAGAATGCT
CAAGGGCAAGCTTGGGTCCCGGCTGCTTATGTTGAGGAACAGGCGGCTCCCGCGCAACCGCCCGTCGCAGCCCCG
AAGCCCCCTCCGCCGCCGCCATCGGCGAAGGCGAAGAGGACAGTTCCGACGCCGCCTGCGAAGCGACCGACGACA
GGACGGAAACCTGGTGATCTGGGCCAGAGGGATTCAGGCATGAGTCTCAACGGCGCCAACAGCGCGGAGGGCAGC
CGCAGTTCAACGCCGACACCCAGCCTCGGCGGCAGTCTGGCAGATGCTCTGCTGGCGCGTAAAAATGCGTTGCAG
AAAGGAGGGCAATGA
Transcript >Ophcf2|03276
ATGGGTATATCGCGACGTCCCAAAAACAAGACTGCCGCCGATGGGCAGGCGGCTGCTTCGGGCGGCCGAGGCGGC
GGCGCGAAACCCAAAAAGGCCACGTTCGACGTGGCGAAGAAGAAGGAGGTTGGTGTATCTGACCTGACTCTGTTG
AGCAAAGTGTCCAATGAGGCCATCAACGAAAACCTGAAGAAGCGTTTTGAGGGCGCCGAGATCTACACTTACATC
GGCCATGTGCTCGTCTCCGTCAATCCCTTCCGAGACCTCGGTATCTACACTGAGAAGGTCCTGGATAGTTACAAA
GGCAAAAACCGGCTCGAGATGCCGCCTCATGTCTTTGCCATTGCTGAGTCCGCCTACTACAATATGAAGGCCTAC
AAAGACAACCAGTGCGTCATCATCTCGGGTGAGTCGGGGGCGGGCAAGACTGAAGCTGCCAAGCGCATCATGCAA
TATATTGCCAGCGTTTCGGGCGAGCAGTCTGGCGATATCAAAAAGATCAAAGAAATGGTACTGGCCACGAATCCG
CTGCTCGAGTCATTCGGAAATGCAAAGACTTTACGAAATAATAACTCGTCTCGGTTTGGCAAATACCTTCAGATA
CACTTCAACTCGACGGGCGAGCCTGTCGGAGCCGACATCACTAACTACCTTCTGGAAAAGACGCGTGTTGTTGGC
CAAATAACGAACGAGAGAAATTTTCACATTTTCTACCAGTTCACCAAGGGCGCGCCCAAGCAGTACCAGGAGCTC
TATGGAATCCAAAGACCAGAAACCTACGTCTACACCAGTCGCTCCAAGTGCTTTGAGGTCGATGGCATCGATGAC
GTCGCCGAATTTCAAGATACCCTCAAGTCCATGAACACAATTGGGTTGAGTCAATCAGAGCAAGACGAGATCTTT
CGCATGTTGGCTGCGGTCCTTTGGATAGGTAATATCCAGTTTCAAGAGGACGAAAACGGCTACGCGGCTGTCGCC
GACCAGTCGGTAGTTGAGTTTGTGGCCTACCTCCTGGAAGTCTCGCCGCAGCAGGTGATCAACGCCATCACGATC
CGCATTTTGACCCCTCGCAACGGCGAAGTCATCGAGTCGCCCGGGAATCCCGCTCAGGCCTCGGCGACACGAGAT
GCCTTGGCCAAGGCCGTCTACAATAATCTCTTCGACTGGATTGTGGAACGCATCAACAAATCCCTCAAATCTCGG
CAAGCAACCACCAACACTATCGGCATCCTGGACATTTACGGCTTCGAGATTTTCGATAAGAACAGCTTCGAGCAA
CTGTGCATCAACTATGTCAACGAGAAGCTGCAACAGATCTTCATCCAGCTCACTCTGAAAACAGAACAGGAAGAG
TACGCCAATGAGAAGATCAAATGGACGCCCATAAAATACTTCGACAACAAGGTAGTGTGCGACCTGATTGAGCAG
ATCAGGCCCCCCGGCATCTTCTCCGCCATGAAGGATGCCACCAAGACGGCTCATGCCGATCCTGCCGCTTGCGAC
CGGACCTTTATGCAGAGCATCAACGGCATGTCTCACGCACATCTGACTCCGCGTCAGGGCAACTTCATCATCAAG
CACTACGCTGGTGACGTCTCCTACACAGTCGACGGTATCACGGACAAGAACAAGGATCAGCTCCTCAAGGGCCTT
CTGAATCTCTTTCAACAGAGCGGGAACCAATTAATTCATACCCTGTTTCCCAATCAGGTCGATCAAGACAATCGA
AAACAGCCACCCTCGGCCGGCGACCGAATCCGTGCTTCGGCGAATGCTCTTGTGGATACACTCATGAAATGTCAG
CCCTCGTACATCCGTACCATCAAGCCCAACGAGAACAAGTCTCCCTCCGAGTACAATAGCTCCAACGTACTGCAT
CAGGTCAAGTACCTGGGTCTTCAAGAGAACGTTCGCATCCGTCGGGCCGGGTTCGCCTACCGGCAAGCCTTTGAT
AAGTTTGTCGACCGCTTCTTCCTCTTGTCTCCCGCCACCTCGTACGCGGGCGAGTACACCTGGAACGGCTCTTAT
GAAAATGCTGTTAAGCAGATCCTCAAAGACACAAGCATTACAAAGGATGAGTGGCAGCTCGGAGTTACGAAGGCA
TTTGTCAAGTCACCAGAGACATTGTTTGCCTTGGAGCACATGAGAGATCGATACTGGCATAACATGGCGACTCGC
ATCCAGCGAATGTGGCGCGCATACCTCGCATACCGAGCCGAATCGGCGACACGCATACAACGCATGTGGAGGAAG
AAGCGAACTGGTGCCGAGTTCTTGCAACTCCGAGACAAGGGTCATCGTCTCTACCAGGGGAGCAAAGAAAGAAGG
CGGATGAGTCTTCTGGGCTCCCGGAGGTTTCTGGGCGATTACTTGGGCGTCAACGCTGCTACCGGCTACGGCGCA
CATGTCCGCAAGGCTGCTGGTATCGACTCTAACGAGCGCGCTGTGTTCTCCTGTCGAGGCGAGATACTGGAGGCC
AAGTTCGGACGATCTAGCAAGCCGAGCCCTCGCACCATCGTCGTCACTAAGAGCAAGTTTTACATCGTTGTGCAA
TTGCTGGTGGACGGTCAGCCGCAGACTTCATTAGAGCGGGCCATTCCCCTCAGCTCCATCCAGTACATTGGGGTT
TCTACGTGCCAGGACGACTGGTTCTCCCTTGGAGTCGGGTCTACTCAGGATCCCGATCCTTTGCTGAATTGCGTC
TTCAAAACCGAACTCTTTACACAGATGCAACGTGTTAGAACCGGCGGTCTCGATCTCAAGATTGCCCCTGCCATA
GAGTATGCTAAGAAACCCGGTAAACCACAGCAAGTCAAGGTCTTGAAAGACTCCCAGCAGCATGCCGACTACTAC
AAGAGTGGCGCTATACACACCACTCAAGGAGAACCTCCAACTTCCGGTTCGAGGCCTTTGCCCAAGGGCAAACCA
AAGCCGCCGCGACCCATCACCAGAGGCAAGCTGATCAAGCCGGGAGGACCGGGCGGCCGGCAGACTAGACCGATG
GGCGGCCGAACTGCACAGCCCAGGCCAGGAGCTGACCCTGCAAGGGCCGCGGCTGTCCCGCCTACGGCGATTGGC
GCACCGGCTGCAACCAAAGCTGTTGCTTCGGCGAACAAAACAGGCGGGGCCAACCGCGATCCGCCCCCCCCGCCA
CCGGCAGCTCCATCCTCTCGCTCCAAAGTCATGGCCAAGGTGTTATATGACTTCGCTAGTCAAAGAGAAAACGAG
CTCTCAATTCATGTGGGGGATATTGTCGAAATTGTACAGAAAGAAAGCAACGGCTGGTGGCTAGCGAAGAATGCT
CAAGGGCAAGCTTGGGTCCCGGCTGCTTATGTTGAGGAACAGGCGGCTCCCGCGCAACCGCCCGTCGCAGCCCCG
AAGCCCCCTCCGCCGCCGCCATCGGCGAAGGCGAAGAGGACAGTTCCGACGCCGCCTGCGAAGCGACCGACGACA
GGACGGAAACCTGGTGATCTGGGCCAGAGGGATTCAGGCATGAGTCTCAACGGCGCCAACAGCGCGGAGGGCAGC
CGCAGTTCAACGCCGACACCCAGCCTCGGCGGCAGTCTGGCAGATGCTCTGCTGGCGCGTAAAAATGCGTTGCAG
AAAGGAGGGCAATGA
Gene >Ophcf2|03276
ATGGTAGGAGATTCCTGAGACTCTTCGCTTAATCTGTGCCTTGGAAAGATGTTGACGAGATTGTCAGGGTATATC
GCGACGTCCCAAAAACAAGACTGCCGCCGATGGGCAGGCGGCTGCTTCGGGCGGCCGAGGCGGCGGCGCGAAACC
CAAAAAGGCCACGTTCGACGTGGCGAAGAAGAAGGAGGTTGGTGTATCTGACCTGACTCTGTTGAGCAAAGTGTC
CAATGAGGCCATCAACGAAAACCTGAAGAAGCGTTTTGAGGGCGCCGAGATCTACACTTACATCGGCCATGTGCT
CGTCTCCGTCAATCCCTTCCGAGACCTCGGTATCTACACTGAGAAGGTCCTGGATAGTTACAAAGGCAAAAACCG
GCTCGAGATGCCGCCTCATGTCTTTGCCATTGCTGAGTCCGCCTACTACAATATGAAGGCCTACAAAGACAACCA
GTGCGTCATCATCTCGGGTGAGTCGGGGGCGGGCAAGACTGAAGCTGCCAAGCGCATCATGCAATATATTGCCAG
CGTTTCGGGCGAGCAGTCTGGCGATATCAAAAAGATCAAAGAAATGGTACTGGCCACGAATCCGCTGCTCGAGTC
ATTCGGAAATGCAAAGACTTTACGAAATAATAACTCGTCTCGGTTTGGCAAATACCTTCAGATACACTTCAACTC
GACGGGCGAGCCTGTCGGAGCCGACATCACTAACTACCTTCTGGAAAAGACGCGTGTTGTTGGCCAAATAACGAA
CGAGAGAAATTTTCACATTTTCTACCAGTTCACCAAGGGCGCGCCCAAGCAGTACCAGGAGCTCTATGGAATCCA
AAGACCAGAAACCTACGTCTACACCAGTCGCTCCAAGTGCTTTGAGGTCGATGGCATCGATGACGTCGCCGAATT
TCAAGATACCCTCAAGTCCATGAACACAATTGGGTTGAGTCAATCAGAGCAAGACGAGATCTTTCGCATGTTGGC
TGCGGTCCTTTGGATAGGTAATATCCAGTTTCAAGAGGACGAAAACGGCTACGCGGCTGTCGCCGACCAGTCGGT
AGTTGAGTTTGTGGCCTACCTCCTGGAAGTCTCGCCGCAGCAGGTGATCAACGCCATCACGATCCGCATTTTGAC
CCCTCGCAACGGCGAAGTCATCGAGTCGCCCGGGAATCCCGCTCAGGCCTCGGCGACACGAGATGCCTTGGCCAA
GGCCGTCTACAATAATCTCTTCGACTGGATTGTGGAACGCATCAACAAATCCCTCAAATCTCGGCAAGCAACCAC
CAACACTATCGGCATCCTGGACATTTACGGCTTCGAGATTTTCGATAAGAACAGCTTCGAGCAACTGTGCATCAA
CTATGTCAACGAGAAGCTGCAACAGATCTTCATCCAGCTCACTCTGAAAACAGAACAGGAAGAGTACGCCAATGA
GAAGATCAAATGGACGCCCATAAAATACTTCGACAACAAGGTAGTGTGCGACCTGATTGAGCAGATCAGGCCCCC
CGGCATCTTCTCCGCCATGAAGGATGCCACCAAGACGGCTCATGCCGATCCTGCCGCTTGCGACCGGACCTTTAT
GCAGAGCATCAACGGCATGTCTCACGCACATCTGACTCCGCGTCAGGGCAACTTCATCATCAAGCACTACGCTGG
TGACGTCTCCTACACAGTCGACGGTATCACGGACAAGAACAAGGATCAGCTCCTCAAGGGCCTTCTGAATCTCTT
TCAACAGAGCGGGAACCAATTAATTCATACCCTGTTTCCCAATCAGGTCGATCAAGACAATCGAAAACAGCCACC
CTCGGCCGGCGACCGAATCCGTGCTTCGGCGAATGCTCTTGTGGATACACTCATGAAATGTCAGCCCTCGTACAT
CCGTACCATCAAGCCCAACGAGAACAAGTCTCCCTCCGAGTACAATAGCTCCAACGTACTGCATCAGGTCAAGTA
CCTGGGTCTTCAAGAGAACGTTCGCATCCGTCGGGCCGGGTTCGCCTACCGGCAAGCCTTTGATAAGTTTGTCGA
CCGCTTCTTCCTCTTGTCTCCCGCCACCTCGTACGCGGGCGAGTACACCTGGAACGGCTCTTATGAAAATGCTGT
TAAGCAGATCCTCAAAGACACAAGCATTACAAAGGATGAGTGGCAGCTCGGAGTTACGAAGGCATTTGTCAAGTC
ACCAGAGACATTGTTTGCCTTGGAGCACATGAGAGATCGATACTGGCATAACATGGCGACTCGCATCCAGCGAAT
GTGGCGCGCATACCTCGCATACCGAGCCGAATCGGCGACACGCATACAACGCATGTGGAGGAAGAAGCGAACTGG
TGCCGAGTTCTTGCAACTCCGAGACAAGGGTCATCGTCTCTACCAGGGGAGCAAAGAAAGAAGGCGGATGAGTCT
TCTGGGCTCCCGGAGGTTTCTGGGCGATTACTTGGGCGTCAACGCTGCTACCGGCTACGGCGCACATGTCCGCAA
GGCTGCTGGTATCGACTCTAACGAGCGCGCTGTGTTCTCCTGTCGAGGCGAGATACTGGAGGCCAAGTTCGGACG
ATCTAGCAAGCCGAGCCCTCGCACCATCGTCGTCACTAAGAGCAAGTTTTACATCGTTGTGCAATTGCTGGTGGA
CGGTCAGCCGCAGACTTCATTAGAGCGGGCCATTCCCCTCAGCTCCATCCAGTACATTGGGGTTTCTACGTGCCA
GGACGACTGGTTCTCCCTTGGAGTCGGGTCTACTCAGGATCCCGATCCTTTGCTGAATTGCGTCTTCAAAACCGA
ACTCTTTACACAGATGCAACGTGTTAGAACCGGCGGTCTCGATCTCAAGATTGCCCCTGCCATAGAGTATGCTAA
GAAACCCGGTAAACCACAGCAAGTCAAGGTCTTGAAAGACTCCCAGCAGCATGCCGACTACTACAAGAGTGGCGC
TATACACACCACTCAAGGAGAACCTCCAACTTCCGGTTCGAGGCCTTTGCCCAAGGGCAAACCAAAGCCGCCGCG
ACCCATCACCAGAGGCAAGCTGATCAAGCCGGGAGGACCGGGCGGCCGGCAGACTAGACCGATGGGCGGCCGAAC
TGCACAGCCCAGGCCAGGAGCTGACCCTGCAAGGGCCGCGGCTGTCCCGCCTACGGCGATTGGCGCACCGGCTGC
AACCAAAGCTGTTGCTTCGGCGAACAAAACAGGCGGGGCCAACCGCGATCCGCCCCCCCCGCCACCGGCAGCTCC
ATCCTCTCGCTCCAAAGTCATGGCCAAGGTGTTATATGACTTCGCTAGTCAAAGAGAAAACGAGCTCTCAATTCA
TGTGGGGGATATTGTCGAAATTGTACAGAAAGAAAGCAACGGTAGGTTCTCAGACCTTCTTCCCCGTGTTTCCGG
GGCTGACTTGTCCCATAGGCTGGTGGCTAGCGAAGAATGCTCAAGGGCAAGCTTGGGTCCCGGCTGCTTATGTTG
AGGAACAGGCGGCTCCCGCGCAACCGCCCGTCGCAGCCCCGAAGCCCCCTCCGCCGCCGCCATCGGCGAAGGCGA
AGAGGACAGTTCCGACGCCGCCTGCGAAGCGACCGACGACAGGACGGAAACCTGGTGATCTGGGCCAGAGGGATT
CAGGCATGAGTCTCAACGGCGCCAACAGCGCGGAGGGCAGCCGCAGTTCAACGCCGACACCCAGCCTCGGCGGCA
GTCTGGCAGATGCTCTGCTGGCGCGTAAAAATGCGTTGCAGAAAGGAGGGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail