Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03269
Gene name
Locationscaffold_03:1773737..1774145
Strand-
Gene length (bp)408
Transcript length (bp)282
Coding sequence length (bp)282
Protein length (aa) 94

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 9.6E-13 22 85

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0779 0.0456 0.9424 0.0861 0.0998 0.006 0.0791 0.139 0.0686 0.0055

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.99981

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3383
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1472
Ophiocordyceps australis 1348a (Ghana) OphauG2|984
Ophiocordyceps australis map64 (Brazil) OphauB2|4882
Ophiocordyceps australis map64 (Brazil) OphauB2|4996
Ophiocordyceps camponoti-floridani Ophcf2|03269 (this protein)
Ophiocordyceps kimflemingae Ophio5|1584
Ophiocordyceps subramaniannii Hirsu2|6324

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03269
MQFSAIVLAVFTLTVAAQDFTGAPTCARNCFYTSMGRADCADKSDMACLCKSRQYIDSVRECVGKACSKKADKKA
TLIYAKQQCSSVGVAIWN*
Coding >Ophcf2|03269
ATGCAATTTTCAGCGATCGTGCTCGCTGTCTTCACTTTGACAGTGGCGGCGCAAGACTTCACGGGTGCCCCGACA
TGCGCCCGAAATTGCTTTTACACCTCCATGGGAAGAGCGGACTGCGCTGACAAAAGCGACATGGCCTGCTTATGC
AAGTCCAGGCAGTACATAGACTCTGTTCGGGAGTGTGTTGGCAAAGCATGCTCAAAGAAAGCAGACAAGAAAGCG
ACCCTGATATACGCGAAACAACAATGCTCGTCAGTAGGAGTTGCCATATGGAACTAG
Transcript >Ophcf2|03269
ATGCAATTTTCAGCGATCGTGCTCGCTGTCTTCACTTTGACAGTGGCGGCGCAAGACTTCACGGGTGCCCCGACA
TGCGCCCGAAATTGCTTTTACACCTCCATGGGAAGAGCGGACTGCGCTGACAAAAGCGACATGGCCTGCTTATGC
AAGTCCAGGCAGTACATAGACTCTGTTCGGGAGTGTGTTGGCAAAGCATGCTCAAAGAAAGCAGACAAGAAAGCG
ACCCTGATATACGCGAAACAACAATGCTCGTCAGTAGGAGTTGCCATATGGAACTAG
Gene >Ophcf2|03269
ATGCAATTTTCAGCGATCGTGCTCGCTGTCTTCACTTTGACAGTGGCGGCGCAAGACTTCACGGGTGCCCCGACA
TGCGCCCGAAATTGCTTTTACACCTCCATGGGAAGAGCGGACTGCGCTGACAAAAGCGACATGGCCTGCTTATGC
AAGTGAGTATTTCACGTTCCTGTTAACCATTTGCTTGTCCAAAAAGTGCTGACACCCGAGAAAAAATAGGTCCAG
GCAGTACATAGACTCTGTTCGGGAGTGTGTTGGCAAAGCATGCTCAAAGAAAGCAGACAAGTCAGTCGCCCTATT
GCGAGTTAGTGCGATGCATTTCGGTTGTGTTAACAGCGATGCAGGAAAGCGACCCTGATATACGCGAAACAACAA
TGCTCGTCAGTAGGAGTTGCCATATGGAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail