Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03267
Gene name
Locationscaffold_03:1699957..1700901
Strand-
Gene length (bp)944
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03764 EFG_IV Elongation factor G, domain IV 1.5E-32 71 189
PF14492 EFG_III Elongation Factor G, domain III 2.3E-29 1 70
PF00679 EFG_C Elongation factor G C-terminus 2.1E-23 192 278

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:1901265 nucleoside phosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.784 0.4886 0.0173 0.1538 0.1651 0.016 0.0386 0.0264 0.085 0.0205

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup427
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6097
Ophiocordyceps australis map64 (Brazil) OphauB2|3213
Ophiocordyceps camponoti-floridani Ophcf2|03267 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7292
Ophiocordyceps kimflemingae Ophio5|8322
Ophiocordyceps subramaniannii Hirsu2|4610

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03267
MSLSIKPKRNADVDHFSKAMNRFQREDPTFRVHVDPESEETIISGMGELHLEVYVERLRREYKADCTTGQPRVAY
RETITRRTDFDFLLKRQSGGPGDYARVAGWIEPNDEPEENHYESQVTGGHIPDKFLTACAKGFELVCKDGPLLGH
HVIGTKMVVNDGATHVTDSSDYAFSLATQMAFRKAFPEAGGQILEPLMKTTVTAPNEFQGHILMLMNRRNAIIHD
TDIGSEDMTLTCDCSLNAMFGFSSHLRAATQGKGEFSMEFSHYAPAPPHLQKELIAKYQAELEAKRTK*
Coding >Ophcf2|03267
ATGTCTCTTTCAATTAAGCCGAAACGGAATGCCGACGTGGATCACTTCAGCAAAGCGATGAATCGGTTTCAACGT
GAGGATCCGACGTTTCGGGTCCACGTTGATCCCGAAAGCGAGGAGACGATTATCTCAGGCATGGGCGAGCTGCAT
CTTGAAGTCTACGTCGAGCGCCTGCGTCGCGAGTACAAGGCGGATTGTACAACAGGCCAACCTCGTGTGGCCTAC
CGAGAGACGATTACCCGACGCACTGACTTCGACTTTCTTCTGAAAAGGCAAAGTGGTGGACCCGGTGATTATGCA
CGTGTGGCCGGTTGGATCGAGCCCAATGATGAACCAGAGGAAAACCACTATGAGAGTCAGGTGACTGGCGGCCAC
ATCCCCGATAAGTTCTTGACGGCTTGCGCCAAGGGCTTTGAACTGGTCTGCAAAGACGGTCCCCTGTTGGGTCAC
CATGTTATTGGGACTAAGATGGTCGTCAACGACGGCGCCACTCACGTTACGGATTCCTCAGACTACGCTTTCAGC
CTCGCCACGCAGATGGCCTTTCGAAAGGCTTTTCCTGAGGCCGGCGGCCAGATCCTGGAACCTTTGATGAAGACG
ACCGTCACAGCGCCGAACGAATTCCAGGGCCATATCTTGATGCTCATGAACAGGAGGAACGCTATCATCCATGAC
ACGGACATTGGGAGCGAGGACATGACGCTTACATGCGATTGCAGCCTCAATGCCATGTTTGGCTTCAGTTCGCAT
TTGCGGGCTGCTACGCAGGGGAAAGGCGAATTTAGCATGGAGTTTAGTCATTACGCTCCGGCGCCTCCCCACCTG
CAGAAAGAGCTGATCGCCAAGTATCAGGCTGAACTCGAGGCCAAGAGGACCAAGTGA
Transcript >Ophcf2|03267
ATGTCTCTTTCAATTAAGCCGAAACGGAATGCCGACGTGGATCACTTCAGCAAAGCGATGAATCGGTTTCAACGT
GAGGATCCGACGTTTCGGGTCCACGTTGATCCCGAAAGCGAGGAGACGATTATCTCAGGCATGGGCGAGCTGCAT
CTTGAAGTCTACGTCGAGCGCCTGCGTCGCGAGTACAAGGCGGATTGTACAACAGGCCAACCTCGTGTGGCCTAC
CGAGAGACGATTACCCGACGCACTGACTTCGACTTTCTTCTGAAAAGGCAAAGTGGTGGACCCGGTGATTATGCA
CGTGTGGCCGGTTGGATCGAGCCCAATGATGAACCAGAGGAAAACCACTATGAGAGTCAGGTGACTGGCGGCCAC
ATCCCCGATAAGTTCTTGACGGCTTGCGCCAAGGGCTTTGAACTGGTCTGCAAAGACGGTCCCCTGTTGGGTCAC
CATGTTATTGGGACTAAGATGGTCGTCAACGACGGCGCCACTCACGTTACGGATTCCTCAGACTACGCTTTCAGC
CTCGCCACGCAGATGGCCTTTCGAAAGGCTTTTCCTGAGGCCGGCGGCCAGATCCTGGAACCTTTGATGAAGACG
ACCGTCACAGCGCCGAACGAATTCCAGGGCCATATCTTGATGCTCATGAACAGGAGGAACGCTATCATCCATGAC
ACGGACATTGGGAGCGAGGACATGACGCTTACATGCGATTGCAGCCTCAATGCCATGTTTGGCTTCAGTTCGCAT
TTGCGGGCTGCTACGCAGGGGAAAGGCGAATTTAGCATGGAGTTTAGTCATTACGCTCCGGCGCCTCCCCACCTG
CAGAAAGAGCTGATCGCCAAGTATCAGGCTGAACTCGAGGCCAAGAGGACCAAGTGA
Gene >Ophcf2|03267
ATGTCTCTTTCAATTAAGCCGAAACGGAATGCCGACGTGGATCACTTCAGCAAAGCGATGAATCGGTTTCAACGT
GAGGATCCGACGTTTCGGGTCCACGTTGATCCCGAAAGCGAGGAGACGATTATCTCAGGCATGGGCGAGCTGCAT
CTTGAAGTCTACGTCGAGCGCCTGCGTCGCGAGTACAAGGCGGATTGTACAACAGGCCAACCTCGTGTGGCCTAC
CGAGAGACGATTACCCGACGCACTGACTTCGACTTTCTTCTGAAAAGGCAAAGTGGTGGACCCGGTGATTATGCA
CGTGTGGCCGGTTGGATCGAGCCCAATGATGAACCAGAGGAAAACCACTATGAGAGTCAGGTGACTGGCGGCCAC
ATCCCCGATAAGTTCTTGACGGCTTGCGCCAAGGGCTTTGAACTGGTCTGCAAAGACGGTCCCCTGTTGGGTCAC
CATGTTATTGGGACTAAGATGGTCGTCAACGACGGCGCCACTCACGTTACGGATTCCTCAGACTACGCTTTCAGC
CTCGCCACGCAGATGGCCTTTCGAAAGGCTTTTCCTGAGGCCGGCGGCCAGATCCTGGAACCTTTGATGAAGACG
ACCGTCACAGCGCCGAACGAATTCCAGGGCCATATCTTGATGCTCATGAACAGGAGGAACGCTATCATCCATGAC
ACGGACATTGGGAGCGAGGACATGACGCTTACATGCGATTGCAGCCTCAATGCCATGTTTGGCTTCAGTTCGCAT
TTGCGGGCTGCTACGCAGGGGAAAGGCGAATTTAGCATGGAGTTTAGTCATTACGCTCCGGCGCCTCCCCACCTG
CAGTAAGTTGAGCTCTATTGAAACGCTTTAGAGGTGAAGTCGCTGACGGGGTCAATAACCATAGGAAAGAGCTGA
TCGCCAAGTATCAGGCTGAACTCGAGGCCAAGAGGACCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail