Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03265
Gene name
Locationscaffold_03:1694182..1696656
Strand+
Gene length (bp)2474
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain 1.5E-28 605 699
PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain) 2.7E-17 75 160
PF00128 Alpha-amylase Alpha amylase, catalytic domain 4.2E-10 223 300

GO

GO Term Description Terminal node
GO:0043169 cation binding Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5955 0.4298 0.0909 0.0751 0.0777 0.0352 0.1052 0.2596 0.0904 0.0176

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH13_8 2.2E-151 250 543

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup847
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4138
Ophiocordyceps australis map64 (Brazil) OphauB2|2509
Ophiocordyceps camponoti-floridani Ophcf2|03265 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7294
Ophiocordyceps kimflemingae Ophio5|521
Ophiocordyceps subramaniannii Hirsu2|4591

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03265
MNTIAKTSSPFLHLDAIGGGANDGPNDGTGVIKLDPWLSPFSDALKRRYAKAQDWMKTINDHEGGMEKFSRGIEK
YGFNVDDHGNVTYREWAPNAKGAFLIGDFNYWDRSSHPMQKDSYGVFDITIPASNGQPAIPHKSKVKICLVLPNG
ERIERIPAWIKYVTQDLSVSPVYDARFWNPPPGERHLFKHSRPKKPAGARVYEAHVGISSPDQRVATYKEFTINM
LPRIRDLGYNVIQLMAIMEHAYYASFGYQVNSFFAASSRFGPPEDLKELIDTAHGMGLVVLLDVVHSHASKNVLD
GLNEFDGTDHQYFHSGGKGCHDQWDSRLFNYGHHEVLRYLLSNLRFWMDEYQFDGFRFDGVTSMLYTHHGMGTGF
SGGYHEYFGGDVDEEAVVYLMLANELLHSLFPDCLTIAEDVSGMPALCLPLSLGGIGFDYRLSMAVPDMWIKILK
EQKDEQWDMANICFTLTNRRHGEKTIAYCESHDQALVGDKTLMMHLCDAQLYSNMSILTELTPVIDRGMALHKMI
RLLTQSLGGEGYLNFEGNEFGHPEWLDFPRQGNNNSFWYARRQLNLTNDHLLRYQFLDNFDRLMNKCEAKYGWLS
SPQAYISLKHEGDKVIVYERAGLVFVFNFHPNESFSDYRVGVEVAGTYRIVLNSDARQVGGHGRVEETTRFFTTP
MQWNGRKNWTHVYIPCRTALVLAPDEESR*
Coding >Ophcf2|03265
ATGAATACAATTGCCAAGACCTCGTCCCCCTTCTTGCACCTCGACGCTATCGGAGGCGGCGCAAATGACGGCCCC
AACGATGGGACTGGGGTTATCAAGTTGGATCCATGGCTATCCCCCTTCAGCGACGCTCTGAAGCGGCGATACGCC
AAAGCGCAGGACTGGATGAAGACAATCAATGACCACGAGGGCGGTATGGAGAAGTTCTCTAGAGGAATCGAGAAG
TATGGTTTCAACGTGGATGACCATGGGAATGTTACCTACCGAGAATGGGCGCCTAACGCGAAGGGTGCATTTCTT
ATTGGGGATTTCAACTACTGGGACCGCTCTTCCCACCCGATGCAGAAAGATTCGTATGGCGTCTTCGACATTACT
ATTCCCGCCAGCAACGGCCAGCCGGCAATTCCTCACAAATCCAAAGTCAAGATTTGTCTCGTTCTTCCAAACGGT
GAGCGAATAGAACGCATCCCGGCGTGGATCAAATACGTCACTCAAGACCTGTCCGTCTCGCCTGTGTATGACGCC
CGATTTTGGAACCCACCGCCAGGCGAAAGACATTTATTCAAGCATTCGCGCCCTAAGAAACCAGCCGGGGCACGG
GTATACGAGGCTCATGTCGGCATCTCGTCCCCGGATCAGAGGGTGGCAACGTACAAAGAGTTCACAATCAATATG
CTGCCTCGCATAAGAGACCTGGGATACAACGTCATCCAGTTGATGGCAATCATGGAACATGCTTATTACGCAAGC
TTTGGCTATCAAGTAAACAGCTTCTTTGCCGCGAGCAGCCGCTTCGGTCCACCAGAGGATCTGAAAGAGCTCATT
GATACTGCTCACGGCATGGGTCTCGTTGTCTTACTCGACGTCGTCCATAGTCATGCCTCCAAAAATGTGCTCGAT
GGTTTGAACGAGTTTGACGGAACAGACCATCAGTACTTCCACAGTGGAGGCAAGGGCTGCCATGACCAGTGGGAC
AGCAGGTTGTTCAATTATGGCCACCACGAAGTACTTCGATATCTTCTTAGCAACCTGCGTTTCTGGATGGATGAG
TATCAGTTTGACGGCTTTCGCTTTGACGGCGTGACTAGTATGCTGTATACCCATCATGGCATGGGCACGGGATTC
TCTGGAGGGTATCACGAATACTTTGGCGGTGATGTGGACGAAGAGGCCGTTGTGTATCTCATGCTCGCCAACGAG
TTGTTGCACTCACTTTTTCCGGACTGCTTGACCATCGCCGAAGACGTTTCAGGGATGCCTGCTCTTTGTCTCCCA
CTCTCGTTGGGCGGCATCGGATTTGACTATCGTCTGTCAATGGCAGTGCCCGATATGTGGATCAAAATTTTGAAG
GAGCAGAAGGACGAGCAATGGGACATGGCAAACATCTGTTTCACATTGACAAATCGGCGACACGGCGAAAAGACG
ATTGCTTATTGCGAAAGCCATGATCAAGCGCTGGTTGGGGACAAAACGTTGATGATGCATCTTTGTGATGCTCAG
CTATACTCGAATATGTCGATTTTAACCGAGCTGACTCCAGTCATAGACCGTGGAATGGCCCTTCATAAGATGATA
CGACTCCTCACACAAAGCTTAGGAGGAGAAGGATATCTCAATTTCGAGGGTAACGAATTCGGCCATCCTGAGTGG
CTTGACTTCCCACGACAAGGCAACAACAATTCGTTTTGGTATGCACGACGCCAGTTGAACTTGACAAATGATCAT
CTCCTTCGGTATCAATTCCTAGACAACTTTGATCGACTGATGAATAAATGCGAGGCAAAGTATGGATGGTTGTCT
TCGCCCCAGGCCTATATATCCCTCAAGCACGAGGGAGACAAGGTAATTGTCTATGAAAGAGCAGGTCTGGTATTT
GTCTTCAACTTTCATCCGAATGAAAGCTTCAGTGACTACCGCGTCGGCGTTGAAGTCGCAGGAACCTATCGCATT
GTTCTGAATAGCGACGCCCGACAGGTTGGAGGCCACGGCAGAGTTGAAGAGACAACGCGTTTCTTCACCACGCCA
ATGCAATGGAACGGGCGCAAAAACTGGACTCACGTCTACATTCCCTGTCGCACCGCGCTGGTTCTTGCGCCGGAT
GAAGAAAGCCGTTGA
Transcript >Ophcf2|03265
ATGAATACAATTGCCAAGACCTCGTCCCCCTTCTTGCACCTCGACGCTATCGGAGGCGGCGCAAATGACGGCCCC
AACGATGGGACTGGGGTTATCAAGTTGGATCCATGGCTATCCCCCTTCAGCGACGCTCTGAAGCGGCGATACGCC
AAAGCGCAGGACTGGATGAAGACAATCAATGACCACGAGGGCGGTATGGAGAAGTTCTCTAGAGGAATCGAGAAG
TATGGTTTCAACGTGGATGACCATGGGAATGTTACCTACCGAGAATGGGCGCCTAACGCGAAGGGTGCATTTCTT
ATTGGGGATTTCAACTACTGGGACCGCTCTTCCCACCCGATGCAGAAAGATTCGTATGGCGTCTTCGACATTACT
ATTCCCGCCAGCAACGGCCAGCCGGCAATTCCTCACAAATCCAAAGTCAAGATTTGTCTCGTTCTTCCAAACGGT
GAGCGAATAGAACGCATCCCGGCGTGGATCAAATACGTCACTCAAGACCTGTCCGTCTCGCCTGTGTATGACGCC
CGATTTTGGAACCCACCGCCAGGCGAAAGACATTTATTCAAGCATTCGCGCCCTAAGAAACCAGCCGGGGCACGG
GTATACGAGGCTCATGTCGGCATCTCGTCCCCGGATCAGAGGGTGGCAACGTACAAAGAGTTCACAATCAATATG
CTGCCTCGCATAAGAGACCTGGGATACAACGTCATCCAGTTGATGGCAATCATGGAACATGCTTATTACGCAAGC
TTTGGCTATCAAGTAAACAGCTTCTTTGCCGCGAGCAGCCGCTTCGGTCCACCAGAGGATCTGAAAGAGCTCATT
GATACTGCTCACGGCATGGGTCTCGTTGTCTTACTCGACGTCGTCCATAGTCATGCCTCCAAAAATGTGCTCGAT
GGTTTGAACGAGTTTGACGGAACAGACCATCAGTACTTCCACAGTGGAGGCAAGGGCTGCCATGACCAGTGGGAC
AGCAGGTTGTTCAATTATGGCCACCACGAAGTACTTCGATATCTTCTTAGCAACCTGCGTTTCTGGATGGATGAG
TATCAGTTTGACGGCTTTCGCTTTGACGGCGTGACTAGTATGCTGTATACCCATCATGGCATGGGCACGGGATTC
TCTGGAGGGTATCACGAATACTTTGGCGGTGATGTGGACGAAGAGGCCGTTGTGTATCTCATGCTCGCCAACGAG
TTGTTGCACTCACTTTTTCCGGACTGCTTGACCATCGCCGAAGACGTTTCAGGGATGCCTGCTCTTTGTCTCCCA
CTCTCGTTGGGCGGCATCGGATTTGACTATCGTCTGTCAATGGCAGTGCCCGATATGTGGATCAAAATTTTGAAG
GAGCAGAAGGACGAGCAATGGGACATGGCAAACATCTGTTTCACATTGACAAATCGGCGACACGGCGAAAAGACG
ATTGCTTATTGCGAAAGCCATGATCAAGCGCTGGTTGGGGACAAAACGTTGATGATGCATCTTTGTGATGCTCAG
CTATACTCGAATATGTCGATTTTAACCGAGCTGACTCCAGTCATAGACCGTGGAATGGCCCTTCATAAGATGATA
CGACTCCTCACACAAAGCTTAGGAGGAGAAGGATATCTCAATTTCGAGGGTAACGAATTCGGCCATCCTGAGTGG
CTTGACTTCCCACGACAAGGCAACAACAATTCGTTTTGGTATGCACGACGCCAGTTGAACTTGACAAATGATCAT
CTCCTTCGGTATCAATTCCTAGACAACTTTGATCGACTGATGAATAAATGCGAGGCAAAGTATGGATGGTTGTCT
TCGCCCCAGGCCTATATATCCCTCAAGCACGAGGGAGACAAGGTAATTGTCTATGAAAGAGCAGGTCTGGTATTT
GTCTTCAACTTTCATCCGAATGAAAGCTTCAGTGACTACCGCGTCGGCGTTGAAGTCGCAGGAACCTATCGCATT
GTTCTGAATAGCGACGCCCGACAGGTTGGAGGCCACGGCAGAGTTGAAGAGACAACGCGTTTCTTCACCACGCCA
ATGCAATGGAACGGGCGCAAAAACTGGACTCACGTCTACATTCCCTGTCGCACCGCGCTGGTTCTTGCGCCGGAT
GAAGAAAGCCGTTGA
Gene >Ophcf2|03265
ATGAATACAATTGCCAAGACCTCGTCCCCCTTCTTGCACCTCGACGCTATCGGAGGCGGCGCAAATGACGGCCCC
AACGATGGGACTGGTGACTTTCCCCGGGGTTTATGAATGGAAAACAGCGAACTAATCAATACCAGGGGTTATCAA
GTTGGATCCATGGCTATCCCCCTTCAGCGACGCTCTGAAGCGGCGATACGCCAAAGCGCAGGACTGGATGAAGAC
AATCAATGACCACGAGGGCGGTATGGAGAAGTTCTCTAGAGTATGCATCTCTGAATTTGGCCTTGTCTTTGAAGC
TGAAGTTCTCTTCTAGGGAATCGAGAAGTATGGTTTCAACGTGGATGACCATGGGAATGTTACCTACCGAGAATG
GGCGCCTAACGCGAAGGGTGCATTTCTTATTGGGGATTTCAGTAAGGTCAATAGAGCTTGTGGCTGCAGACCGCC
TACTGACGCCATATTCAAGACTACTGGGACCGCTCTTCCCACCCGATGCAGAAAGATTCGTATGGCGTCTTCGAC
ATTACTATTCCCGCCAGCAACGGCCAGCCGGCAATTCCTCACAAATCCAAAGTCAAGGTACAGCTACCTTTTGCT
GTAAGAAGTGGAGCTGATGGGAAGGCAGATTTGTCTCGTTCTTCCAAACGGTGAGCGAATAGAACGCATCCCGGC
GTGGATCAAATACGTCACTCAAGACCTGTCCGTCTCGCCTGTGTATGACGCCCGATTTTGGAACCCACCGCCAGG
CGAAAGACATTTATTCAAGCATTCGCGCCCTAAGAAACCAGCCGGGGCACGGGTATACGAGGCTCATGTCGGCAT
CTCGTCCCCGGATCAGAGGGTGGCAACGTACAAAGAGTTCACAATCAATATGCTGCCTCGCATAAGAGACCTGGG
ATACAACGTCATCCAGTTGATGGCAATCATGGAACATGCTTATTACGCAAGCTTTGGCTATCAAGTAAACAGCTT
CTTTGCCGCGAGCAGCCGCTTCGGTCCACCAGAGGATCTGAAAGAGCTCATTGATACTGCTCACGGCATGGGTCT
CGTTGTCTTACTCGACGTCGTCCATAGTCATGCCTCCAAAAATGTGCTCGATGGTTTGAACGAGTTTGACGGAAC
AGACCATCAGTACTTCCACAGTGGAGGCAAGGGCTGCCATGACCAGTGGGACAGCAGGTTGTTCAATTATGGCCA
CCACGAAGTACTTCGATATCTTCTTAGCAACCTGCGTTTCTGGATGGATGAGTATCAGTTTGACGGCTTTCGCTT
TGACGGCGTGACTAGTATGCTGTATACCCATCATGGCATGGGCACGTGAGTAGCAAAGCACATCTTGGCCCCGCT
TTCTGATGATTATCTGACTTTCATTAGGGGATTCTCTGGAGGGTATCACGAATACTTTGGCGGTGATGTGGACGA
AGAGGCCGTTGTGTATCTCATGCTCGCCAACGAGTTGTTGCACTCACTTTTTCCGGACTGCTTGACCATCGCCGA
AGACGTTTCAGGGATGCCTGCTCTTTGTCTCCCACTCTCGTTGGGCGGCATCGGATTTGACTATCGTCTGTCAAT
GGCAGTGCCCGATATGTGGATCAAAATTTTGAAGGAGCAGAAGGACGAGCAATGGGACATGGCAAACATCTGTTT
CACATTGACAAATCGGCGACACGGCGAAAAGACGATTGCTTATTGCGAAAGCCATGATCAAGCGTATGAAGAATG
ACCCTATCTAGCCTGGCAACGAGTGCTGATGATGTCATTAGGCTGGTTGGGGACAAAACGTTGATGATGCATCTT
TGTGATGCTCAGCTATACTCGAATATGTCGATTTTAACCGAGCTGACTCCAGTCATAGACCGTGGAATGGCCCTT
CATAAGATGATACGACTCCTCACACAAAGCTTAGGAGGAGAAGGATATCTCAATTTCGAGGGTAACGAATTCGGC
CATCCTGAGTGGCTTGACTTCCCACGACAAGGCAACAACAATTCGTTTTGGTATGCACGACGCCAGTTGAACTTG
ACAAATGATCATCTCCTTCGGTATCAATTCCTAGACAACTTTGATCGACTGATGAATAAATGCGAGGCAAAGTAT
GGATGGTTGTCTTCGCCCCAGGCCTATATATCCCTCAAGCACGAGGGAGACAAGGTAATTGTCTATGAAAGAGCA
GGTCTGGTATTTGTCTTCAACTTTCATCCGAATGAAAGCTTCAGTGACTACCGCGTCGGCGTTGAAGTCGCAGGA
ACCTATCGCATTGTTCTGAATAGCGACGCCCGACAGGTTGGAGGCCACGGCAGAGTTGAAGAGACAACGCGTTTC
TTCACCACGCCAATGCAATGGAACGGGCGCAAAAACTGGACTCACGTCTACATTCCCTGTCGCACCGCGCTGGTA
GGTCTACTCGACTTGGCGCCGCTCCCCTGCTGACGCGTGACTAGGTTCTTGCGCCGGATGAAGAAAGCCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail