Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03256
Gene name
Locationscaffold_03:1387838..1388352
Strand+
Gene length (bp)514
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00125 Histone Core histone H2A/H2B/H3/H4 7.9E-49 1 132
PF15715 PAF PCNA-associated factor histone like domain 7.6E-05 1 58

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3188 0.5916 0.0341 0.0974 0.1221 0.0159 0.03 0.0676 0.0333 0.0089

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4919
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3323
Ophiocordyceps australis map64 (Brazil) OphauB2|2492
Ophiocordyceps camponoti-floridani Ophcf2|03256 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1525
Ophiocordyceps kimflemingae Ophio5|1265
Ophiocordyceps subramaniannii Hirsu2|1541

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03256
MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREI
AQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERN*
Coding >Ophcf2|03256
ATGGCCCGCACAAAGCAAACAGCTCGCAAATCAACTGGTGGCAAGGCACCCCGGAAGCAACTGGCTTCCAAAGCT
GCCAGGAAGAGTGCCCCGTCTACGGGAGGTGTCAAGAAGCCCCATCGCTATAAGCCTGGTACCGTCGCCCTACGC
GAGATTCGCCGCTACCAGAAGTCCACGGAGCTCTTGATCCGCAAACTTCCTTTCCAGCGCCTGGTTCGCGAGATC
GCTCAGGATTTCAAGAGCGACTTGCGCTTCCAGTCATCCGCTATTGGGGCTCTCCAGGAGTCAGTCGAATCGTAT
CTCGTCTCTCTGTTCGAAGATACGAACCTCTGCGCTATTCACGCAAAGCGCGTGACGATCCAGTCCAAAGATATT
CAGCTTGCTCGGCGGTTGCGTGGGGAGCGAAATTAA
Transcript >Ophcf2|03256
ATGGCCCGCACAAAGCAAACAGCTCGCAAATCAACTGGTGGCAAGGCACCCCGGAAGCAACTGGCTTCCAAAGCT
GCCAGGAAGAGTGCCCCGTCTACGGGAGGTGTCAAGAAGCCCCATCGCTATAAGCCTGGTACCGTCGCCCTACGC
GAGATTCGCCGCTACCAGAAGTCCACGGAGCTCTTGATCCGCAAACTTCCTTTCCAGCGCCTGGTTCGCGAGATC
GCTCAGGATTTCAAGAGCGACTTGCGCTTCCAGTCATCCGCTATTGGGGCTCTCCAGGAGTCAGTCGAATCGTAT
CTCGTCTCTCTGTTCGAAGATACGAACCTCTGCGCTATTCACGCAAAGCGCGTGACGATCCAGTCCAAAGATATT
CAGCTTGCTCGGCGGTTGCGTGGGGAGCGAAATTAA
Gene >Ophcf2|03256
ATGGCCCGCACAAAGCAAACAGCTCGCAAATCAACTGGTGGCAAGGCACCCCGGAAGCAACTGGCTTCCAAAGCT
GGTATGGACATATTTGATCATCTCTGGCTCGAATCGTTTGTCACTAACCAGGCGCAGCCAGGAAGAGTGCCCCGT
CTACGGGAGGTGTCAAGAAGCCCCATCGCTATAAGCCTGGTACCGTCGCCCTACGCGAGATTCGCCGCTACCAGA
AGTCCACGGAGCTCTTGATCCGCAAACTTCCTTTCCAGCGCCTGGTGAGTCCCTTTCACTCCGATTCACAGAACG
CGCTAACATTTGACAGGTTCGCGAGATCGCTCAGGATTTCAAGAGCGACTTGCGCTTCCAGTCATCCGCTATTGG
GGCTCTCCAGGAGTCAGTCGAATCGTATCTCGTCTCTCTGTTCGAAGATACGAACCTCTGCGCTATTCACGCAAA
GCGCGTGACGATCCAGTCCAAAGATATTCAGCTTGCTCGGCGGTTGCGTGGGGAGCGAAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail