Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03253
Gene name
Locationscaffold_03:1241806..1244188
Strand+
Gene length (bp)2382
Transcript length (bp)2283
Coding sequence length (bp)2283
Protein length (aa) 761

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04109 ATG9 Autophagy protein ATG9 1.1E-195 44 533

GO

GO Term Description Terminal node
GO:0006914 autophagy Yes
GO:0008152 metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0044248 cellular catabolic process No
GO:0009987 cellular process No
GO:0061919 process utilizing autophagic mechanism No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 294 316 22
3 382 404 22
4 414 433 19
5 481 503 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03253
MHWDGLTTQRQVHQDVVARSRPATRPESLVTGLVAGSQREKSLWRWASTSNLDNFMRGVYQYYEGGGLWCILCAN
ALWLLETLFVAVLLTLLGQCIDYAALPRSKSLDQIIVRQCTRKMSGLWNTGIWLYSFFFLWKSAQYFLEIRRLLH
IRDFYLHLLEIPEQDMQTVSWQDVVARIMSLRDQNPKTATNMPQNVRRFLGSQSKDRLDAHDIANRLMRRDNYLI
AMINKDILDLSLPLPFLRGRQLYSKTMEWYLHYSILDMAFNDFGQVRQDFLRADRRGQLSQKLKQRFYFAGLLNL
IFAPVVFAYVVIVYFFMYYNEYQKDPKLAAARKYTALAEWKFREFNELPHIFYERLHMSFPFATRYIDQFPKRMT
EEVARSIAFISGAITAVLAVCTILDSELFLGFEITKDRTVLFYLGLFGGIWAMTRGIVSEESTVFNPEYALRSVI
EYTHYMPDHWLGRLHSFDVKQEFSELYKMKVVIFLEEIMGIITTPLLLLFSLPNCSEQIIDFFREFTVHIDGLGY
VCSFAVFDFKKDGGAGVQLGGGHDVREEYYSTKHGKMAASYYGFIDNYVINPRTGIPGHMPPGMRQQFYPPPTFP
SLNSPTLATDMQGSHVGRPVESGRTRSRMVGLSGKRVARRGGHAIALPSPMASVLLDPDHQPPAVNLVARSMHNP
RHNRASYRGKDQVIEETAEDRDAEDEPRQGDYGLMEESTWETSPGQDLSRETSTVNVDETEAGVLEMIYQLQQTH
QNYYRRRGVI*
Coding >Ophcf2|03253
ATGCACTGGGACGGTTTGACAACCCAGCGACAGGTACATCAAGATGTCGTGGCTCGTTCACGGCCCGCTACTCGA
CCCGAATCCCTGGTGACGGGGCTCGTGGCTGGCAGCCAGCGCGAAAAGTCGCTCTGGAGGTGGGCCAGCACGTCA
AACTTGGATAACTTCATGCGAGGCGTATATCAGTATTACGAAGGAGGTGGCCTCTGGTGCATTCTTTGCGCAAAT
GCACTCTGGCTCTTGGAGACCTTATTCGTGGCTGTGCTTCTCACGCTTCTTGGTCAATGTATCGACTACGCCGCG
CTGCCTCGAAGCAAATCTCTTGATCAAATCATTGTCAGGCAGTGCACGAGGAAGATGTCGGGCCTTTGGAACACG
GGTATCTGGCTGTACTCCTTCTTCTTTTTATGGAAGTCGGCGCAATATTTCTTAGAGATCAGGCGACTCCTCCAC
ATTCGCGACTTTTATCTTCATCTCCTTGAAATTCCCGAGCAGGATATGCAAACAGTGTCGTGGCAAGACGTTGTG
GCTCGGATCATGAGTCTTAGAGATCAAAACCCCAAGACGGCAACGAATATGCCTCAAAATGTGCGACGGTTTCTC
GGCAGCCAGTCGAAGGATAGATTGGACGCTCATGATATAGCGAACCGGCTAATGCGCAGAGATAACTACCTCATT
GCCATGATCAATAAGGATATTCTAGACCTGTCACTTCCACTTCCATTTTTGAGGGGCAGGCAACTATATTCTAAG
ACGATGGAGTGGTATCTGCATTACAGCATTCTAGACATGGCATTTAACGATTTCGGACAGGTTCGGCAAGATTTC
CTCAGAGCGGATCGAAGAGGTCAACTTAGCCAGAAGCTTAAGCAGCGTTTTTACTTTGCGGGATTGCTAAATCTC
ATCTTTGCGCCGGTGGTGTTCGCCTACGTAGTGATCGTCTACTTTTTCATGTACTACAATGAATATCAAAAAGAT
CCGAAACTAGCAGCTGCCCGAAAGTACACTGCGCTTGCGGAGTGGAAATTCCGAGAGTTCAACGAATTGCCGCAT
ATCTTTTACGAAAGGCTGCACATGTCGTTTCCATTCGCAACGCGATACATAGATCAGTTCCCAAAACGAATGACT
GAGGAAGTTGCTCGAAGCATTGCTTTCATATCCGGCGCAATCACGGCCGTGCTAGCAGTCTGCACCATCCTGGAC
TCGGAACTCTTCCTCGGTTTCGAGATCACGAAGGATCGAACAGTGTTGTTCTACCTAGGCTTGTTCGGGGGCATC
TGGGCCATGACACGCGGGATAGTATCGGAAGAATCGACTGTCTTTAACCCGGAGTACGCTCTGCGCAGCGTCATC
GAATACACCCACTACATGCCGGATCATTGGCTGGGTCGTCTTCACAGCTTTGATGTCAAGCAGGAATTTTCGGAA
CTCTACAAAATGAAGGTTGTCATTTTTCTCGAAGAGATAATGGGTATTATCACGACACCATTGCTACTCTTGTTT
TCACTGCCAAACTGCAGCGAGCAGATTATTGACTTCTTCCGCGAGTTCACGGTACATATCGACGGACTGGGCTAC
GTATGCTCATTCGCCGTTTTCGACTTCAAGAAGGACGGCGGTGCTGGGGTTCAACTCGGCGGCGGTCATGACGTC
AGAGAAGAGTACTACTCGACAAAGCATGGTAAAATGGCCGCATCGTATTATGGCTTCATAGATAATTATGTCATC
AATCCGAGGACAGGTATCCCAGGACACATGCCGCCCGGGATGCGACAGCAATTTTATCCGCCACCGACATTTCCG
AGCCTGAACTCGCCCACCCTGGCTACAGATATGCAGGGCTCACATGTGGGCCGGCCTGTTGAATCTGGTCGGACG
CGAAGCAGGATGGTAGGGCTAAGTGGAAAGCGGGTAGCAAGGCGAGGGGGACACGCCATCGCACTACCATCTCCG
ATGGCCTCTGTGCTTCTCGACCCAGACCACCAGCCGCCAGCGGTTAACTTAGTGGCGAGAAGCATGCATAATCCG
CGACATAACCGTGCCAGCTACCGTGGGAAAGATCAAGTAATTGAAGAGACGGCTGAAGATAGGGATGCCGAAGAT
GAGCCGAGGCAAGGGGACTATGGGCTAATGGAAGAATCCACATGGGAAACATCGCCCGGTCAGGATTTGAGCCGC
GAAACTAGCACGGTCAATGTGGATGAGACTGAAGCAGGAGTCTTGGAGATGATCTACCAGCTGCAGCAAACGCAC
CAAAACTACTATCGGCGTAGAGGCGTCATTTGA
Transcript >Ophcf2|03253
ATGCACTGGGACGGTTTGACAACCCAGCGACAGGTACATCAAGATGTCGTGGCTCGTTCACGGCCCGCTACTCGA
CCCGAATCCCTGGTGACGGGGCTCGTGGCTGGCAGCCAGCGCGAAAAGTCGCTCTGGAGGTGGGCCAGCACGTCA
AACTTGGATAACTTCATGCGAGGCGTATATCAGTATTACGAAGGAGGTGGCCTCTGGTGCATTCTTTGCGCAAAT
GCACTCTGGCTCTTGGAGACCTTATTCGTGGCTGTGCTTCTCACGCTTCTTGGTCAATGTATCGACTACGCCGCG
CTGCCTCGAAGCAAATCTCTTGATCAAATCATTGTCAGGCAGTGCACGAGGAAGATGTCGGGCCTTTGGAACACG
GGTATCTGGCTGTACTCCTTCTTCTTTTTATGGAAGTCGGCGCAATATTTCTTAGAGATCAGGCGACTCCTCCAC
ATTCGCGACTTTTATCTTCATCTCCTTGAAATTCCCGAGCAGGATATGCAAACAGTGTCGTGGCAAGACGTTGTG
GCTCGGATCATGAGTCTTAGAGATCAAAACCCCAAGACGGCAACGAATATGCCTCAAAATGTGCGACGGTTTCTC
GGCAGCCAGTCGAAGGATAGATTGGACGCTCATGATATAGCGAACCGGCTAATGCGCAGAGATAACTACCTCATT
GCCATGATCAATAAGGATATTCTAGACCTGTCACTTCCACTTCCATTTTTGAGGGGCAGGCAACTATATTCTAAG
ACGATGGAGTGGTATCTGCATTACAGCATTCTAGACATGGCATTTAACGATTTCGGACAGGTTCGGCAAGATTTC
CTCAGAGCGGATCGAAGAGGTCAACTTAGCCAGAAGCTTAAGCAGCGTTTTTACTTTGCGGGATTGCTAAATCTC
ATCTTTGCGCCGGTGGTGTTCGCCTACGTAGTGATCGTCTACTTTTTCATGTACTACAATGAATATCAAAAAGAT
CCGAAACTAGCAGCTGCCCGAAAGTACACTGCGCTTGCGGAGTGGAAATTCCGAGAGTTCAACGAATTGCCGCAT
ATCTTTTACGAAAGGCTGCACATGTCGTTTCCATTCGCAACGCGATACATAGATCAGTTCCCAAAACGAATGACT
GAGGAAGTTGCTCGAAGCATTGCTTTCATATCCGGCGCAATCACGGCCGTGCTAGCAGTCTGCACCATCCTGGAC
TCGGAACTCTTCCTCGGTTTCGAGATCACGAAGGATCGAACAGTGTTGTTCTACCTAGGCTTGTTCGGGGGCATC
TGGGCCATGACACGCGGGATAGTATCGGAAGAATCGACTGTCTTTAACCCGGAGTACGCTCTGCGCAGCGTCATC
GAATACACCCACTACATGCCGGATCATTGGCTGGGTCGTCTTCACAGCTTTGATGTCAAGCAGGAATTTTCGGAA
CTCTACAAAATGAAGGTTGTCATTTTTCTCGAAGAGATAATGGGTATTATCACGACACCATTGCTACTCTTGTTT
TCACTGCCAAACTGCAGCGAGCAGATTATTGACTTCTTCCGCGAGTTCACGGTACATATCGACGGACTGGGCTAC
GTATGCTCATTCGCCGTTTTCGACTTCAAGAAGGACGGCGGTGCTGGGGTTCAACTCGGCGGCGGTCATGACGTC
AGAGAAGAGTACTACTCGACAAAGCATGGTAAAATGGCCGCATCGTATTATGGCTTCATAGATAATTATGTCATC
AATCCGAGGACAGGTATCCCAGGACACATGCCGCCCGGGATGCGACAGCAATTTTATCCGCCACCGACATTTCCG
AGCCTGAACTCGCCCACCCTGGCTACAGATATGCAGGGCTCACATGTGGGCCGGCCTGTTGAATCTGGTCGGACG
CGAAGCAGGATGGTAGGGCTAAGTGGAAAGCGGGTAGCAAGGCGAGGGGGACACGCCATCGCACTACCATCTCCG
ATGGCCTCTGTGCTTCTCGACCCAGACCACCAGCCGCCAGCGGTTAACTTAGTGGCGAGAAGCATGCATAATCCG
CGACATAACCGTGCCAGCTACCGTGGGAAAGATCAAGTAATTGAAGAGACGGCTGAAGATAGGGATGCCGAAGAT
GAGCCGAGGCAAGGGGACTATGGGCTAATGGAAGAATCCACATGGGAAACATCGCCCGGTCAGGATTTGAGCCGC
GAAACTAGCACGGTCAATGTGGATGAGACTGAAGCAGGAGTCTTGGAGATGATCTACCAGCTGCAGCAAACGCAC
CAAAACTACTATCGGCGTAGAGGCGTCATTTGA
Gene >Ophcf2|03253
ATGCACTGGGACGGTTTGACAACCCAGCGACAGGTACATCAAGATGTCGTGGCTCGTTCACGGCCCGCTACTCGA
CCCGAATCCCTGGTGACGGGGCTCGTGGCTGGCAGCCAGCGCGAAAAGTCGCTCTGGAGGTGGGCCAGCACGTCA
AACTTGGATAACTTCATGCGAGGCGTATATCAGTATTACGAAGGAGGTGGCCTCTGGTGCATTCTTTGCGCAAAT
GCACTCTGGCTCTTGTTAGTTCGATCCGGCGCCTGGATTGACCTGGCTGACAGTAGCTATATAGGGAGACCTTAT
TCGTGGCTGTGCTTCTCACGCTTCTTGGTCAATGTATCGACTACGCCGCGCTGCCTCGAAGCAAATCTCTTGATC
AAATCATTGTCAGGCAGTGCACGAGGAAGATGTCGGGCCTTTGGAACACGGGTATCTGGCTGTACTCCTTCTTCT
TTTTATGGAAGTCGGCGCAATATTTCTTAGAGATCAGGCGACTCCTCCACATTCGCGACTTTTATCTTCATCTCC
TTGAAATTCCCGAGCAGGATATGCAAACAGTGTCGTGGCAAGACGTTGTGGCTCGGATCATGAGTCTTAGAGATC
AAAACCCCAAGACGGCAACGAATATGCCTCAAAATGTGCGACGGTTTCTCGGCAGCCAGTCGAAGGATAGATTGG
ACGCTCATGATATAGCGAACCGGCTAATGCGCAGAGATAACTACCTCATTGCCATGATCAATAAGGATATTCTAG
ACCTGTCACTTCCACTTCCATTTTTGAGGGGCAGGCAACTATATTCTAAGACGATGGAGTGGTATCTGCATTACA
GCATTCTAGACATGGCATTTAACGATTTCGGACAGGTTCGGCAAGATTTCCTCAGAGCGGATCGAAGAGGTCAAC
TTAGCCAGAAGCTTAAGCAGCGTTTTTACTTTGCGGGATTGCTAAATCTCATCTTTGCGCCGGTGGTGTTCGCCT
ACGTAGTGATCGTCTACTTTTTCATGTACTACAATGTGAGTCTTCCACCACTCTGATGAAGCTCTCGGTAACATT
GTACGTCAGGAATATCAAAAAGATCCGAAACTAGCAGCTGCCCGAAAGTACACTGCGCTTGCGGAGTGGAAATTC
CGAGAGTTCAACGAATTGCCGCATATCTTTTACGAAAGGCTGCACATGTCGTTTCCATTCGCAACGCGATACATA
GATCAGTTCCCAAAACGAATGACTGAGGAAGTTGCTCGAAGCATTGCTTTCATATCCGGCGCAATCACGGCCGTG
CTAGCAGTCTGCACCATCCTGGACTCGGAACTCTTCCTCGGTTTCGAGATCACGAAGGATCGAACAGTGTTGTTC
TACCTAGGCTTGTTCGGGGGCATCTGGGCCATGACACGCGGGATAGTATCGGAAGAATCGACTGTCTTTAACCCG
GAGTACGCTCTGCGCAGCGTCATCGAATACACCCACTACATGCCGGATCATTGGCTGGGTCGTCTTCACAGCTTT
GATGTCAAGCAGGAATTTTCGGAACTCTACAAAATGAAGGTTGTCATTTTTCTCGAAGAGATAATGGGTATTATC
ACGACACCATTGCTACTCTTGTTTTCACTGCCAAACTGCAGCGAGCAGATTATTGACTTCTTCCGCGAGTTCACG
GTACATATCGACGGACTGGGCTACGTATGCTCATTCGCCGTTTTCGACTTCAAGAAGGACGGCGGTGCTGGGGTT
CAACTCGGCGGCGGTCATGACGTCAGAGAAGAGTACTACTCGACAAAGCATGGTAAAATGGCCGCATCGTATTAT
GGCTTCATAGATAATTATGTCATCAATCCGAGGACAGGTATCCCAGGACACATGCCGCCCGGGATGCGACAGCAA
TTTTATCCGCCACCGACATTTCCGAGCCTGAACTCGCCCACCCTGGCTACAGATATGCAGGGCTCACATGTGGGC
CGGCCTGTTGAATCTGGTCGGACGCGAAGCAGGATGGTAGGGCTAAGTGGAAAGCGGGTAGCAAGGCGAGGGGGA
CACGCCATCGCACTACCATCTCCGATGGCCTCTGTGCTTCTCGACCCAGACCACCAGCCGCCAGCGGTTAACTTA
GTGGCGAGAAGCATGCATAATCCGCGACATAACCGTGCCAGCTACCGTGGGAAAGATCAAGTAATTGAAGAGACG
GCTGAAGATAGGGATGCCGAAGATGAGCCGAGGCAAGGGGACTATGGGCTAATGGAAGAATCCACATGGGAAACA
TCGCCCGGTCAGGATTTGAGCCGCGAAACTAGCACGGTCAATGTGGATGAGACTGAAGCAGGAGTCTTGGAGATG
ATCTACCAGCTGCAGCAAACGCACCAAAACTACTATCGGCGTAGAGGCGTCATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail