Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03249
Gene name
Locationscaffold_03:1130642..1132411
Strand+
Gene length (bp)1769
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 3.4E-28 253 525
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 4.2E-11 21 87

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 239 261 22
2 281 303 22
3 363 385 22
4 400 422 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03249
MMASFVAGELDSLPLMSRDEIESLIANGRKLVIFRGQVLRTDAWLPYHPGGDKAILHMVGRDATAEIEALHSDHA
RQKMLRYRIGRVDGLWKNFTPPIQGGTFRTLADMGEASSSIADSAKSDATFMSITSRSPSPVFHVDGHLRRRLKT
GQERPGPLDEFDPSPKRSSPDMDGISYLDSITRDQISLDLDKYPASDLETQARILAKYRELHQRVYDEGLYNCGA
FAYACDIVRYVTFFLLMIVCLRIGQYAIAGIFLGFTWHQLVFAAHDAGHMGITHDYKIDTVIGIIIADFIGGLSL
GWWKRNHNVHHIVTNAPEHDPDIEHMPLFAVSHRLLGSLRSTYYDRVMKYDAVAQFLLRFQSWTYYPLLSLGRFN
LYVLSWDYLLANRGPKKGPGAWHRWLELAGQVFFWTWFGYGIVYNVIPDGWSRFIFVMTSHIASSPLHVQIVLSH
FAMSTTDLGPQESFPQKMLRTTMDVDCPPWLDFVHGGLQFQAVHHLFPRVPRHNLRRARTLVREFCDEVGIPYAL
YGFADGNKQVISRLSEVSRQAAILAKCQRTVAMRGSFLGVGHGH*
Coding >Ophcf2|03249
ATGATGGCATCCTTCGTCGCCGGCGAGCTGGACTCGCTTCCGCTCATGTCGCGCGATGAGATTGAGTCGCTGATA
GCCAATGGGCGCAAACTCGTCATCTTTCGCGGCCAGGTGCTCAGGACAGACGCCTGGCTCCCGTACCATCCAGGC
GGCGACAAGGCCATACTACACATGGTGGGCAGAGATGCGACGGCTGAGATTGAAGCCCTCCATTCTGATCATGCC
CGACAGAAGATGCTCCGATACCGGATTGGGAGAGTCGACGGCTTGTGGAAAAACTTCACCCCCCCTATTCAAGGT
GGCACTTTTCGAACCCTTGCCGACATGGGCGAGGCGTCCTCGTCAATTGCAGACAGCGCAAAGAGCGACGCGACT
TTCATGTCGATCACGTCGCGCTCGCCGTCTCCCGTCTTTCATGTCGATGGCCATCTGCGAAGACGGCTCAAGACC
GGCCAGGAACGCCCTGGGCCCCTCGACGAGTTTGACCCTTCGCCCAAGCGCAGCAGCCCTGATATGGACGGCATC
TCGTATCTCGATTCCATTACGCGCGATCAGATTAGCCTTGACCTCGATAAGTATCCGGCCAGCGACCTGGAGACC
CAAGCTCGAATCCTCGCAAAGTACCGGGAGCTGCATCAACGAGTTTACGACGAGGGCCTATACAATTGCGGTGCC
TTTGCCTACGCCTGTGACATTGTCCGCTATGTGACTTTCTTTCTCCTCATGATCGTCTGTCTTCGCATCGGCCAG
TATGCGATTGCCGGCATCTTCCTCGGATTCACATGGCATCAGCTCGTCTTCGCCGCGCACGATGCAGGCCACATG
GGCATCACGCACGATTACAAAATCGACACTGTCATCGGCATCATCATTGCCGACTTCATTGGCGGCTTGTCTCTG
GGTTGGTGGAAGAGGAACCACAACGTTCACCACATTGTGACCAACGCGCCCGAACACGATCCGGACATCGAGCAT
ATGCCGTTGTTCGCCGTATCGCATCGTCTGTTGGGCAGCCTCCGATCTACCTATTACGACCGCGTAATGAAGTAT
GATGCCGTGGCTCAGTTCTTGCTCCGTTTTCAGTCGTGGACTTACTATCCGCTGCTGTCGCTGGGGCGCTTTAAC
CTCTACGTCCTATCGTGGGATTATTTACTCGCTAACCGAGGTCCGAAAAAGGGTCCTGGCGCTTGGCACCGTTGG
CTGGAGCTCGCCGGTCAGGTATTCTTCTGGACCTGGTTCGGCTACGGCATCGTGTACAATGTCATACCGGACGGC
TGGTCTCGCTTCATCTTCGTCATGACGAGCCACATCGCTTCGTCGCCTCTACACGTGCAAATTGTCCTGTCTCAT
TTTGCCATGAGCACAACTGACCTGGGACCGCAAGAGTCGTTTCCCCAGAAAATGCTTCGAACGACTATGGATGTC
GATTGCCCGCCCTGGCTTGATTTCGTTCATGGAGGGCTGCAGTTTCAGGCTGTTCACCATCTCTTCCCCCGCGTC
CCCCGTCACAATCTTCGCAGGGCGCGGACGCTGGTACGCGAGTTTTGCGACGAGGTGGGCATACCGTACGCTCTG
TACGGCTTCGCAGATGGCAACAAGCAGGTCATTAGCCGCCTGTCCGAGGTTTCAAGACAGGCGGCTATTTTGGCT
AAGTGCCAGAGAACCGTCGCCATGCGTGGGAGTTTCTTGGGCGTTGGTCATGGTCATTAA
Transcript >Ophcf2|03249
ATGATGGCATCCTTCGTCGCCGGCGAGCTGGACTCGCTTCCGCTCATGTCGCGCGATGAGATTGAGTCGCTGATA
GCCAATGGGCGCAAACTCGTCATCTTTCGCGGCCAGGTGCTCAGGACAGACGCCTGGCTCCCGTACCATCCAGGC
GGCGACAAGGCCATACTACACATGGTGGGCAGAGATGCGACGGCTGAGATTGAAGCCCTCCATTCTGATCATGCC
CGACAGAAGATGCTCCGATACCGGATTGGGAGAGTCGACGGCTTGTGGAAAAACTTCACCCCCCCTATTCAAGGT
GGCACTTTTCGAACCCTTGCCGACATGGGCGAGGCGTCCTCGTCAATTGCAGACAGCGCAAAGAGCGACGCGACT
TTCATGTCGATCACGTCGCGCTCGCCGTCTCCCGTCTTTCATGTCGATGGCCATCTGCGAAGACGGCTCAAGACC
GGCCAGGAACGCCCTGGGCCCCTCGACGAGTTTGACCCTTCGCCCAAGCGCAGCAGCCCTGATATGGACGGCATC
TCGTATCTCGATTCCATTACGCGCGATCAGATTAGCCTTGACCTCGATAAGTATCCGGCCAGCGACCTGGAGACC
CAAGCTCGAATCCTCGCAAAGTACCGGGAGCTGCATCAACGAGTTTACGACGAGGGCCTATACAATTGCGGTGCC
TTTGCCTACGCCTGTGACATTGTCCGCTATGTGACTTTCTTTCTCCTCATGATCGTCTGTCTTCGCATCGGCCAG
TATGCGATTGCCGGCATCTTCCTCGGATTCACATGGCATCAGCTCGTCTTCGCCGCGCACGATGCAGGCCACATG
GGCATCACGCACGATTACAAAATCGACACTGTCATCGGCATCATCATTGCCGACTTCATTGGCGGCTTGTCTCTG
GGTTGGTGGAAGAGGAACCACAACGTTCACCACATTGTGACCAACGCGCCCGAACACGATCCGGACATCGAGCAT
ATGCCGTTGTTCGCCGTATCGCATCGTCTGTTGGGCAGCCTCCGATCTACCTATTACGACCGCGTAATGAAGTAT
GATGCCGTGGCTCAGTTCTTGCTCCGTTTTCAGTCGTGGACTTACTATCCGCTGCTGTCGCTGGGGCGCTTTAAC
CTCTACGTCCTATCGTGGGATTATTTACTCGCTAACCGAGGTCCGAAAAAGGGTCCTGGCGCTTGGCACCGTTGG
CTGGAGCTCGCCGGTCAGGTATTCTTCTGGACCTGGTTCGGCTACGGCATCGTGTACAATGTCATACCGGACGGC
TGGTCTCGCTTCATCTTCGTCATGACGAGCCACATCGCTTCGTCGCCTCTACACGTGCAAATTGTCCTGTCTCAT
TTTGCCATGAGCACAACTGACCTGGGACCGCAAGAGTCGTTTCCCCAGAAAATGCTTCGAACGACTATGGATGTC
GATTGCCCGCCCTGGCTTGATTTCGTTCATGGAGGGCTGCAGTTTCAGGCTGTTCACCATCTCTTCCCCCGCGTC
CCCCGTCACAATCTTCGCAGGGCGCGGACGCTGGTACGCGAGTTTTGCGACGAGGTGGGCATACCGTACGCTCTG
TACGGCTTCGCAGATGGCAACAAGCAGGTCATTAGCCGCCTGTCCGAGGTTTCAAGACAGGCGGCTATTTTGGCT
AAGTGCCAGAGAACCGTCGCCATGCGTGGGAGTTTCTTGGGCGTTGGTCATGGTCATTAA
Gene >Ophcf2|03249
ATGATGGCATCCTTCGTCGCCGGCGAGCTGGACTCGCTTCCGCTCATGTCGCGCGATGAGATTGAGTCGCTGATA
GCCAATGGGCGCAAACTCGTCATCTTTCGCGGCCAGGTGCTCAGGACAGACGCCTGGCTCCCGTACCATCCAGGC
GGCGACAAGGCCATACTACACATGGTGGGCAGAGATGCGACGGCTGAGATTGAAGCGTACATTTACCCCTGTGGC
CAAAACGTCAGCTTGTCAGGTCGCTGACGTCTTTTGGCAGCCTCCATTCTGATCATGCCCGACAGAAGATGCTCC
GATACCGGATTGGGAGAGTCGACGGCTTGTGGAAAAACTTCACCCCCCCTATTCAAGGTGGCACTTTTCGAACCC
TTGCCGACATGGGCGAGGCGTCCTCGTCAATTGCAGACAGCGCAAAGAGCGACGCGACTTTCATGTCGATCACGT
CGCGCTCGCCGTCTCCCGTCTTTCATGTCGATGGCCATCTGCGAAGACGGCTCAAGACCGGCCAGGAACGCCCTG
GGCCCCTCGACGAGTTTGACCCTTCGCCCAAGCGCAGCAGCCCTGATATGGACGGCATCTCGTATCTCGATTCCA
TTACGCGCGATCAGATTAGCCTTGACCTCGATAAGTATCCGGCCAGCGACCTGGAGACCCAAGCTCGAATCCTCG
CAAAGTACCGGGAGCTGCATCAACGAGTTTACGACGAGGGCCTATACAATTGCGGTGCCTTTGCCTACGCCTGTG
ACATTGTCCGCTATGTGACTTTCTTTCTCCTCATGATCGTCTGTCTTCGCATCGGCCAGTATGCGATTGCCGGCA
TCTTCCTCGGATTCACATGGCATCAGCTCGTCTTCGCCGCGCACGATGCAGGCCACATGGGCATCACGCACGATT
ACAAAATCGACACTGTCATCGGCATCATCATTGCCGACTTCATTGGCGGCTTGTCTCTGGGTTGGTGGAAGAGGA
ACCACAACGTTCACCACATTGTGACCAACGCGCCCGAACACGATCCGGACATCGAGCATATGCCGTTGTTCGCCG
TATCGCATCGTCTGTTGGGCAGCCTCCGATCTACCTATTACGACCGCGTAATGAAGTATGATGCCGTGGCTCAGT
TCTTGCTCCGTTTTCAGTCGTGGACTTACTATCCGCTGCTGTCGCTGGGGCGCTTTAACCTCTACGTCCTATCGT
GGGATTATTTACTCGCTAACCGAGGTCCGAAAAAGGGTCCTGGCGCTTGGCACCGTTGGCTGGAGCTCGCCGGTC
AGGTATTCTTCTGGACCTGGTTCGGCTACGGCATCGTGTACAATGTCATACCGGACGGCTGGTCTCGCTTCATCT
TCGTCATGACGAGCCACATCGCTTCGTCGCCTCTACACGTGCAAATTGTCCTGTCTCATTTTGCCATGAGCACAA
CTGACCTGGGACCGCAAGAGTCGTTTCCCCAGAAAATGCTTCGAACGACTATGGATGTCGATTGCCCGCCCTGGC
TTGATTTCGTTCATGGAGGGCTGCAGTTTCAGGCTGTTCACCATCTCTTCCCCCGCGTCCCCCGTCACAATCTTC
GCAGGGCGCGGACGCTGGTACGCGAGTTTTGCGACGAGGTGGGCATACCGTACGCTCTGTACGGCTTCGCAGATG
GCAACAAGCAGGTCATTAGCCGCCTGTCCGAGGTTTCAAGACAGGCGGCTATTTTGGCTAAGTGCCAGAGAACCG
TCGCCATGCGTGGGAGTTTCTTGGGCGTTGGTCATGGTCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail