Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03238
Gene name
Locationscaffold_03:1103078..1104064
Strand+
Gene length (bp)986
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07534 TLD TLD 2.2E-09 97 163
PF07534 TLD TLD 2.0E-13 201 273

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole Nuclear export signal 0.6487 0.3505 0.0665 0.1693 0.3025 0.0948 0.2053 0.5828 0.5436 0.0508

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2719
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2066
Ophiocordyceps australis map64 (Brazil) OphauB2|5599
Ophiocordyceps camponoti-floridani Ophcf2|03238 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4862
Ophiocordyceps kimflemingae Ophio5|80
Ophiocordyceps subramaniannii Hirsu2|4274

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03238
MWTGLVRRFSVEDGQFPESDGGRQAPTDDGIHGVFAPATVAAQQRAFCYRPPPLDPIVLHASPVEGGAGRLLLST
TVAEEIRAMVPERLRIVEDWRLVYSLERDGASLATLYQRARPFDGGRVGFVLVVKDQEGGTFGAYLSEHPHPASS
YFGNGECFLWRVSALASLPPPPSSDTTHLTRHTTLASPTASGSSTPGELIRFKAFPYSGLNDCYINCEVAFLSVG
AGGGHYGLWLDDSLDIGHSSQCDTFGNEPLSDAGEKFGVLGVELWVLGA*
Coding >Ophcf2|03238
ATGTGGACGGGCCTCGTTCGGCGTTTCTCCGTCGAAGACGGGCAGTTCCCCGAAAGCGACGGCGGGAGACAGGCG
CCGACGGACGATGGCATCCACGGCGTCTTCGCCCCTGCGACTGTCGCCGCGCAGCAGAGAGCGTTTTGCTACCGG
CCGCCGCCGCTGGATCCCATCGTGCTGCACGCGTCGCCGGTGGAAGGCGGGGCAGGGCGGCTGCTGCTTTCGACG
ACGGTGGCCGAGGAGATTCGAGCCATGGTGCCGGAGAGGCTGCGCATCGTCGAGGACTGGCGCCTCGTCTATAGT
TTGGAGCGGGATGGCGCTAGTCTTGCCACGCTGTATCAGCGGGCGAGGCCGTTTGATGGGGGGAGGGTTGGGTTC
GTCCTCGTCGTCAAGGACCAGGAGGGTGGGACATTCGGAGCCTATCTCTCCGAACATCCTCATCCCGCATCCTCG
TATTTTGGCAACGGCGAATGCTTCCTCTGGCGCGTTTCCGCCCTTGCCTCCCTCCCACCGCCCCCGTCCAGCGAC
ACAACCCACCTGACGCGCCACACGACGCTGGCCTCGCCCACGGCGAGCGGCTCCTCCACGCCGGGCGAGCTGATC
CGCTTCAAGGCTTTCCCTTACAGCGGTCTGAACGACTGCTACATCAACTGCGAGGTCGCTTTCCTCAGCGTCGGC
GCTGGCGGTGGCCATTACGGCCTGTGGCTCGACGACTCGCTCGATATCGGCCACAGTTCACAGTGCGATACCTTT
GGCAACGAGCCATTGAGTGACGCTGGTGAGAAGTTTGGCGTCTTGGGGGTCGAGCTGTGGGTGCTGGGCGCCTGA
Transcript >Ophcf2|03238
ATGTGGACGGGCCTCGTTCGGCGTTTCTCCGTCGAAGACGGGCAGTTCCCCGAAAGCGACGGCGGGAGACAGGCG
CCGACGGACGATGGCATCCACGGCGTCTTCGCCCCTGCGACTGTCGCCGCGCAGCAGAGAGCGTTTTGCTACCGG
CCGCCGCCGCTGGATCCCATCGTGCTGCACGCGTCGCCGGTGGAAGGCGGGGCAGGGCGGCTGCTGCTTTCGACG
ACGGTGGCCGAGGAGATTCGAGCCATGGTGCCGGAGAGGCTGCGCATCGTCGAGGACTGGCGCCTCGTCTATAGT
TTGGAGCGGGATGGCGCTAGTCTTGCCACGCTGTATCAGCGGGCGAGGCCGTTTGATGGGGGGAGGGTTGGGTTC
GTCCTCGTCGTCAAGGACCAGGAGGGTGGGACATTCGGAGCCTATCTCTCCGAACATCCTCATCCCGCATCCTCG
TATTTTGGCAACGGCGAATGCTTCCTCTGGCGCGTTTCCGCCCTTGCCTCCCTCCCACCGCCCCCGTCCAGCGAC
ACAACCCACCTGACGCGCCACACGACGCTGGCCTCGCCCACGGCGAGCGGCTCCTCCACGCCGGGCGAGCTGATC
CGCTTCAAGGCTTTCCCTTACAGCGGTCTGAACGACTGCTACATCAACTGCGAGGTCGCTTTCCTCAGCGTCGGC
GCTGGCGGTGGCCATTACGGCCTGTGGCTCGACGACTCGCTCGATATCGGCCACAGTTCACAGTGCGATACCTTT
GGCAACGAGCCATTGAGTGACGCTGGTGAGAAGTTTGGCGTCTTGGGGGTCGAGCTGTGGGTGCTGGGCGCCTGA
Gene >Ophcf2|03238
ATGTGGACGGGCCTCGTTCGGCGTTTCTCCGTCGAAGACGGGCAGTTCCCCGAAAGCGACGGCGGGAGACAGGCG
CCGACGGACGATGGCATCCACGGCGTCTTCGCCCCTGCGACTGTCGCCGCGCAGCAGAGAGCGTTTTGCTACCGG
CCGCCGCCGCTGGATCCCATCGTGCTGCACGCGTCGCCGGTGGAAGGCGGGGCAGGGCGGCTGCTGCTTTCGACG
ACGGTGGCCGAGGAGATTCGAGCCATGGTGCCGGAGAGGCTGCGCATCGTCGAGGACTGGCGCCTCGTCTATAGT
TTGGAGCGGGATGGCGCTAGTCTTGCCACGCTGTATCAGCGGGCGAGGCCGTTTGATGGGGGGAGGGTTGGGTTC
GTCCTCGTCGTCAAGGACCAGGAGGGTGGGGTGAGTGCCGGCCTCGGGATATATCAATGGAGCTTTCCCGGTGAA
GGAGAAGAACGGCGTGATGTCTTCCTTTGTCATCTCTTCCCCTTTCCTTGCTTCGACCTGGGCTGACTCGGATTT
GCGATGACCCGGTTGTGGTCACGTATACGCGCGCTTTCCAGACATTCGGAGCCTATCTCTCCGAACATCCTCATC
CCGCATCCTCGTATTTTGGCAACGGCGAATGCTTCCTCTGGCGCGTTTCCGCCCTTGCCTCCCTCCCACCGCCCC
CGTCCAGCGACACAACCCACCTGACGCGCCACACGACGCTGGCCTCGCCCACGGCGAGCGGCTCCTCCACGCCGG
GCGAGCTGATCCGCTTCAAGGCTTTCCCTTACAGCGGTCTGAACGACTGCTACATCAACTGCGAGGTCGCTTTCC
TCAGCGTCGGCGCTGGCGGTGGCCATTACGGCCTGTGGCTCGACGACTCGCTCGATATCGGCCACAGTTCACAGT
GCGATACCTTTGGCAACGAGCCATTGAGTGACGCTGGTGAGAAGTTTGGCGTCTTGGGGGTCGAGCTGTGGGTGC
TGGGCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail