Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03227
Gene name
Locationscaffold_03:1000067..1001042
Strand+
Gene length (bp)975
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase 8.8E-26 32 188

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016780 phosphotransferase activity, for other substituted phosphate groups Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 67 84 17
3 104 123 19
4 130 152 22
5 196 218 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03227
MGSGAQRQPAMEKQKMLLSSDLVGHFSLVRAMHLADLITLMNGFCGVMSIFSSLRYTLGSPTDVDNAWLALALLP
FGLVFDFLDGKVARWRNKSSLMGQELDSLADLISFGVAPAMVAFTLGLRSPIDTLGLSFFVLCGLTRLARFNVTV
AALPKDASGKSAYFEGTPIPTSLAVDALMAYWLHKGWILDDLPLGVYFPASALEFHPALFIFLIHGCLMTSKTIR
IPKP*
Coding >Ophcf2|03227
ATGGGGTCTGGAGCGCAGAGACAGCCTGCCATGGAGAAGCAGAAGATGCTGCTTTCTTCCGATTTGGTTGGCCAT
TTCTCGCTCGTGAGGGCCATGCATCTCGCCGACCTCATCACCCTGATGAACGGCTTCTGCGGCGTCATGTCCATC
TTCTCCTCTCTCCGCTACACGCTCGGCTCCCCCACAGACGTGGACAATGCATGGCTCGCCCTCGCGCTTCTCCCC
TTTGGCCTCGTCTTCGACTTCTTGGATGGCAAGGTGGCGCGCTGGCGGAATAAGAGTAGTCTCATGGGTCAGGAA
CTTGATTCGCTGGCCGACCTCATCTCCTTCGGCGTCGCGCCCGCAATGGTGGCCTTCACCCTCGGCCTTCGCTCC
CCCATCGACACTCTAGGCCTGTCCTTCTTCGTCCTCTGCGGCCTCACCCGCCTCGCCCGCTTCAACGTTACCGTC
GCCGCCCTCCCCAAAGACGCGTCGGGGAAGAGCGCCTACTTCGAAGGCACCCCGATCCCAACCTCTCTCGCCGTT
GACGCCCTCATGGCCTACTGGCTTCACAAGGGCTGGATCTTGGACGATTTGCCCCTGGGCGTCTACTTCCCCGCC
TCGGCATTAGAGTTTCATCCTGCCCTCTTCATCTTCCTTATTCACGGCTGTCTCATGACCAGCAAGACTATTCGC
ATACCCAAGCCCTGA
Transcript >Ophcf2|03227
ATGGGGTCTGGAGCGCAGAGACAGCCTGCCATGGAGAAGCAGAAGATGCTGCTTTCTTCCGATTTGGTTGGCCAT
TTCTCGCTCGTGAGGGCCATGCATCTCGCCGACCTCATCACCCTGATGAACGGCTTCTGCGGCGTCATGTCCATC
TTCTCCTCTCTCCGCTACACGCTCGGCTCCCCCACAGACGTGGACAATGCATGGCTCGCCCTCGCGCTTCTCCCC
TTTGGCCTCGTCTTCGACTTCTTGGATGGCAAGGTGGCGCGCTGGCGGAATAAGAGTAGTCTCATGGGTCAGGAA
CTTGATTCGCTGGCCGACCTCATCTCCTTCGGCGTCGCGCCCGCAATGGTGGCCTTCACCCTCGGCCTTCGCTCC
CCCATCGACACTCTAGGCCTGTCCTTCTTCGTCCTCTGCGGCCTCACCCGCCTCGCCCGCTTCAACGTTACCGTC
GCCGCCCTCCCCAAAGACGCGTCGGGGAAGAGCGCCTACTTCGAAGGCACCCCGATCCCAACCTCTCTCGCCGTT
GACGCCCTCATGGCCTACTGGCTTCACAAGGGCTGGATCTTGGACGATTTGCCCCTGGGCGTCTACTTCCCCGCC
TCGGCATTAGAGTTTCATCCTGCCCTCTTCATCTTCCTTATTCACGGCTGTCTCATGACCAGCAAGACTATTCGC
ATACCCAAGCCCTGA
Gene >Ophcf2|03227
ATGGGGTCTGGAGCGCAGAGACAGCCTGGTGAGTTTTAGTTTTTTTTTTTCCCCCGAGGGCAGCTGACGATCAGA
GAGAGGTCATTCCGTGGGTGAGCGGGCTGGTGAAGAGGAAGGCTGACTGATGTGACGTTGGTTTAGCCATGGAGA
AGCAGAAGATGCTGCTTTCTTCCGATTTGGTTGGCCATTTCTCGCTCGTGAGGGCCATGCATCTCGCCGACCTCA
TCACCCTGATGAACGGTACAAACCTCGACCCCCGAAAATCCCTCATGGCTGACTGACGTCTCTGACCTCTCTCTC
TCTCTCTCTCTTCTTTTCCCGCAGGCTTCTGCGGCGTCATGTCCATCTTCTCCTCTCTCCGCTACACGCTCGGCT
CCCCCACAGACGTGGACAATGCATGGCTCGCCCTCGCGCTTCTCCCCTTTGGCCTCGTCTTCGACTTCTTGGATG
GCAAGGTGGCGCGCTGGCGGAATAAGAGTAGTCTCATGGGTCAGGAACTTGATTCGCTGGCCGACCTCGTGTGTT
TAAACCCCCTTCCCCCTTTGCCTTTCTTCTCACTCTACGGTTCCTTTTACGGTGTGCTGATCTTCTCACCATCAT
CACAAGATCTCCTTCGGCGTCGCGCCCGCAATGGTGGCCTTCACCCTCGGCCTTCGCTCCCCCATCGACACTCTA
GGCCTGTCCTTCTTCGTCCTCTGCGGCCTCACCCGCCTCGCCCGCTTCAACGTTACCGTCGCCGCCCTCCCCAAA
GACGCGTCGGGGAAGAGCGCCTACTTCGAAGGCACCCCGATCCCAACCTCTCTCGCCGTTGACGCCCTCATGGCC
TACTGGCTTCACAAGGGCTGGATCTTGGACGATTTGCCCCTGGGCGTCTACTTCCCCGCCTCGGCATTAGAGTTT
CATCCTGCCCTCTTCATCTTCCTTATTCACGGCTGTCTCATGACCAGCAAGACTATTCGCATACCCAAGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail