Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03217
Gene name
Locationscaffold_03:967101..969110
Strand-
Gene length (bp)2009
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13369 Transglut_core2 Transglutaminase-like superfamily 3.1E-17 196 366
PF08755 YccV-like Hemimethylated DNA-binding protein YccV like 9.3E-10 501 592

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7265 0.4421 0.0681 0.0711 0.1405 0.0256 0.115 0.1261 0.04 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4388
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1169
Ophiocordyceps australis map64 (Brazil) OphauB2|2615
Ophiocordyceps camponoti-floridani Ophcf2|03217 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2005
Ophiocordyceps kimflemingae Ophio5|103
Ophiocordyceps subramaniannii Hirsu2|9089

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03217
MTLEKVPDEIIQHLLYYVSPTDNLQNLQLLSRRFNCLANEPLLWRFHCCSSFEYWHQHHDFRGKLRRKPSEIGWK
QLYIQRLRQNQLVADRLEEIIATKVGRLKRFEEVGRLGYDAKDYLLTQCRTDESADDYLARRHYSNALLGTIHRS
IAIKEWRQLRRDRDSPDARVAGVRLERALGAFDMFVLHDQPGDLDQISQMLDDKAAEFRASQPNLEEMTTRVKAL
ALNSWLRAKGLTGLCNPRRDYGNLRNHLIGQALRHDDHESVPIISSAIFCCLAARIGLTAQCCAFPYYVHAIIFA
PPGWTLDGTRAECAETTERMFLDPYGRDDEVDTVGFQAILEQMGWYNSTEPFFEPVSTTAITLRAARHIRSTFAR
VLELQNDAHPELSQHLCGNSAMNMEAAMYSARWAPLMMMVPRTFEWDDCLANFLRRFASSWPEDIWLIEKYLWPL
YNDSTSQTDGIGRHANRGLDDLWDHLRQLRFHDDSVPAVQARAAVDGNEAVPFKIGQVFRHSRFGWIGVITGWSD
RAARPPPAAVTHEQGEGKQLYFMCFPSTGSEPHVVKADSVEIITDASQVNDDMFPLAGKFFRRFDRESCTFVSNI
REQYPDD*
Coding >Ophcf2|03217
ATGACTCTTGAAAAAGTGCCGGATGAAATTATCCAACACTTGCTTTACTACGTCTCGCCTACAGACAACCTCCAG
AACTTGCAATTGCTGTCGCGACGCTTCAATTGTCTCGCCAACGAGCCTTTGTTGTGGCGCTTTCACTGTTGCTCC
TCATTCGAGTACTGGCACCAGCATCATGACTTTCGCGGCAAACTTCGGCGCAAACCATCAGAGATCGGCTGGAAG
CAATTATATATTCAGAGGTTGCGACAAAACCAGCTTGTAGCCGACAGGCTCGAAGAAATCATCGCGACTAAAGTC
GGTCGCCTGAAGAGATTCGAAGAGGTCGGGCGACTTGGCTATGACGCGAAGGACTACTTGTTAACCCAGTGCCGG
ACGGATGAGTCGGCCGACGATTACCTGGCAAGGAGACACTATAGCAATGCCCTCCTGGGAACAATCCACCGGAGT
ATCGCCATAAAAGAATGGCGTCAGCTTCGGCGGGATCGCGACTCGCCCGATGCTCGCGTTGCAGGCGTTCGGCTT
GAGCGCGCTCTAGGCGCGTTCGACATGTTCGTCTTGCACGATCAGCCCGGCGATTTAGATCAGATATCCCAGATG
CTCGACGACAAGGCCGCCGAGTTCCGCGCGTCACAACCCAACCTCGAAGAAATGACCACTCGAGTCAAGGCCCTC
GCTCTGAACTCATGGCTCCGCGCCAAGGGCCTCACCGGCTTGTGCAACCCGAGACGAGACTACGGCAACCTGCGC
AATCACTTGATCGGCCAGGCTCTCCGGCACGATGACCACGAGTCAGTGCCAATCATATCCAGCGCCATCTTCTGT
TGCCTGGCCGCCAGGATCGGTCTTACAGCTCAATGTTGTGCCTTTCCTTACTACGTTCACGCCATCATCTTCGCG
CCCCCTGGCTGGACACTCGACGGCACTCGCGCTGAATGCGCTGAGACGACAGAGCGCATGTTCCTTGACCCTTAC
GGCCGAGACGACGAAGTCGACACTGTTGGATTCCAGGCCATACTGGAGCAGATGGGCTGGTACAACAGCACCGAG
CCCTTCTTCGAGCCCGTCTCGACAACCGCCATCACGCTGCGAGCCGCGCGTCATATCAGGTCTACGTTTGCTCGC
GTTCTCGAGCTCCAGAACGACGCCCATCCGGAGCTAAGCCAGCACCTCTGCGGCAACAGCGCCATGAATATGGAA
GCCGCCATGTACTCAGCCCGCTGGGCGCCGCTCATGATGATGGTTCCTCGTACGTTCGAGTGGGACGATTGCTTG
GCTAACTTCCTGCGTCGTTTCGCCTCGTCGTGGCCCGAGGATATCTGGCTCATCGAAAAATACCTATGGCCGCTG
TACAACGACTCGACCTCGCAGACAGACGGAATCGGACGTCACGCGAACCGCGGTCTGGACGATCTGTGGGACCAC
CTGCGTCAACTCCGCTTCCACGACGACAGCGTCCCCGCCGTCCAAGCCCGCGCCGCCGTCGACGGCAACGAGGCT
GTCCCCTTCAAGATCGGACAGGTCTTTCGCCACAGCCGCTTTGGTTGGATCGGCGTCATCACTGGCTGGTCTGAT
CGGGCGGCTAGACCCCCGCCCGCGGCCGTTACTCACGAGCAAGGCGAGGGGAAGCAGCTGTACTTTATGTGCTTC
CCCAGCACCGGATCGGAACCACACGTCGTCAAGGCAGATAGCGTCGAAATCATCACCGATGCCTCGCAGGTCAAC
GACGACATGTTCCCGCTGGCCGGCAAGTTCTTCCGTCGCTTTGACCGCGAGTCGTGCACCTTTGTCTCCAATATA
CGGGAGCAGTATCCCGACGACTGA
Transcript >Ophcf2|03217
ATGACTCTTGAAAAAGTGCCGGATGAAATTATCCAACACTTGCTTTACTACGTCTCGCCTACAGACAACCTCCAG
AACTTGCAATTGCTGTCGCGACGCTTCAATTGTCTCGCCAACGAGCCTTTGTTGTGGCGCTTTCACTGTTGCTCC
TCATTCGAGTACTGGCACCAGCATCATGACTTTCGCGGCAAACTTCGGCGCAAACCATCAGAGATCGGCTGGAAG
CAATTATATATTCAGAGGTTGCGACAAAACCAGCTTGTAGCCGACAGGCTCGAAGAAATCATCGCGACTAAAGTC
GGTCGCCTGAAGAGATTCGAAGAGGTCGGGCGACTTGGCTATGACGCGAAGGACTACTTGTTAACCCAGTGCCGG
ACGGATGAGTCGGCCGACGATTACCTGGCAAGGAGACACTATAGCAATGCCCTCCTGGGAACAATCCACCGGAGT
ATCGCCATAAAAGAATGGCGTCAGCTTCGGCGGGATCGCGACTCGCCCGATGCTCGCGTTGCAGGCGTTCGGCTT
GAGCGCGCTCTAGGCGCGTTCGACATGTTCGTCTTGCACGATCAGCCCGGCGATTTAGATCAGATATCCCAGATG
CTCGACGACAAGGCCGCCGAGTTCCGCGCGTCACAACCCAACCTCGAAGAAATGACCACTCGAGTCAAGGCCCTC
GCTCTGAACTCATGGCTCCGCGCCAAGGGCCTCACCGGCTTGTGCAACCCGAGACGAGACTACGGCAACCTGCGC
AATCACTTGATCGGCCAGGCTCTCCGGCACGATGACCACGAGTCAGTGCCAATCATATCCAGCGCCATCTTCTGT
TGCCTGGCCGCCAGGATCGGTCTTACAGCTCAATGTTGTGCCTTTCCTTACTACGTTCACGCCATCATCTTCGCG
CCCCCTGGCTGGACACTCGACGGCACTCGCGCTGAATGCGCTGAGACGACAGAGCGCATGTTCCTTGACCCTTAC
GGCCGAGACGACGAAGTCGACACTGTTGGATTCCAGGCCATACTGGAGCAGATGGGCTGGTACAACAGCACCGAG
CCCTTCTTCGAGCCCGTCTCGACAACCGCCATCACGCTGCGAGCCGCGCGTCATATCAGGTCTACGTTTGCTCGC
GTTCTCGAGCTCCAGAACGACGCCCATCCGGAGCTAAGCCAGCACCTCTGCGGCAACAGCGCCATGAATATGGAA
GCCGCCATGTACTCAGCCCGCTGGGCGCCGCTCATGATGATGGTTCCTCGTACGTTCGAGTGGGACGATTGCTTG
GCTAACTTCCTGCGTCGTTTCGCCTCGTCGTGGCCCGAGGATATCTGGCTCATCGAAAAATACCTATGGCCGCTG
TACAACGACTCGACCTCGCAGACAGACGGAATCGGACGTCACGCGAACCGCGGTCTGGACGATCTGTGGGACCAC
CTGCGTCAACTCCGCTTCCACGACGACAGCGTCCCCGCCGTCCAAGCCCGCGCCGCCGTCGACGGCAACGAGGCT
GTCCCCTTCAAGATCGGACAGGTCTTTCGCCACAGCCGCTTTGGTTGGATCGGCGTCATCACTGGCTGGTCTGAT
CGGGCGGCTAGACCCCCGCCCGCGGCCGTTACTCACGAGCAAGGCGAGGGGAAGCAGCTGTACTTTATGTGCTTC
CCCAGCACCGGATCGGAACCACACGTCGTCAAGGCAGATAGCGTCGAAATCATCACCGATGCCTCGCAGGTCAAC
GACGACATGTTCCCGCTGGCCGGCAAGTTCTTCCGTCGCTTTGACCGCGAGTCGTGCACCTTTGTCTCCAATATA
CGGGAGCAGTATCCCGACGACTGA
Gene >Ophcf2|03217
ATGACTCTTGAAAAAGTGCCGGATGAAATTATCCAACACTTGCTTTACTACGTCTCGCCTACAGACAACCTCCAG
AACTTGCAATTGCTGTCGCGACGCTTCAATTGTCTCGCCAACGAGCCTTTGTTGTGGCGCTTTCACTGTTGCTCC
TCATTCGAGTACTGGCACCAGCATCATGACTTTCGCGGCAAACTTCGGCGCAAACCATCAGAGATCGGCTGGAAG
CAATTATATATTCAGAGGTTGCGACAAAACCAGCTTGTAGCCGACAGGCTCGAAGAAATCATCGCGACTAAAGTC
GGTCGCCTGAAGAGATTCGAAGAGGTCGGGCGACTTGGCTATGACGCGAAGGACTACTTGTTAACCCAGTGCCGG
ACGGATGAGTCGGCCGACGATTACCTGGCAAGGAGGTAATGCTTGTGGTACCTTCACTCCCATTCATTGCTAAAT
AGAGAATTATCAGACACTATAGCAATGCCCTCCTGGGAACAATCCACCGGAGTATCGCCATAAAAGAATGGCGTC
AGCTTCGGCGGGATCGCGACTCGCCCGATGCTCGCGTTGCAGGCGTTCGGCTTGAGCGCGCTCTAGGCGCGTTCG
ACATGTTCGTCTTGCACGATCAGCCCGGCGATTTAGATCAGGCATGTTGAGCTTTCCCGCCTCAGGGCCAACCAT
GGCTGACGTCGGCTCGCAGATATCCCAGATGCTCGACGACAAGGCCGCCGAGTTCCGCGCGTCACAACCCAACCT
CGAAGAAATGACCACTCGAGTCAAGGCCCTCGCTCTGAACTCATGGCTCCGCGCCAAGGGCCTCACCGGCTTGTG
CAACCCGAGACGAGACTACGGCAACCTGCGCAATCACTTGATCGGCCAGGCTCTCCGGCACGATGACCACGAGTC
AGTGCCAATCATATCCAGCGCCATCTTCTGTTGCCTGGCCGCCAGGATCGGTCTTACAGCTCAATGTTGTGCCTT
TCCTTACTACGTTCACGCCATCATCTTCGCGCCCCCTGGCTGGACACTCGACGGCACTCGCGCTGAATGCGCTGA
GACGACAGAGCGCATGTTCCTTGACCCTTACGGCCGAGACGACGAAGTCGACACTGTTGGATTCCAGGCCATACT
GGAGCAGATGGGCTGGTACAACAGCACCGAGCCCTTCTTCGAGCCCGTCTCGACAACCGCCATCACGCTGCGAGC
CGCGCGTCATATCAGGTCTACGTTTGCTCGCGTTCTCGAGCTCCAGAACGACGCCCATCCGGAGCTAAGCCAGCA
CCTCTGCGGCAACAGCGCCATGAATATGGAAGCCGCCATGTACTCAGCCCGCTGGGCGCCGCTCATGATGATGGT
TCCTCGTACGTTCGAGTGGGACGATTGCTTGGCTAACTTCCTGCGTCGTTTCGCCTCGTCGTGGCCCGAGGATAT
CTGGCTCATCGAAAAATACCTATGGCCGCTGTACAACGACTCGACCTCGCAGACAGACGGAATCGGACGTCACGC
GAACCGCGGTCTGGACGATCTGTGGGACCACCTGCGTCAACTCCGCTTCCACGACGACAGCGTCCCCGCCGTCCA
AGCCCGCGCCGCCGTCGACGGCAACGAGGCTGTCCCCTTCAAGATCGGACAGGTCTTTCGCCACAGCCGCTTTGG
TTGGATCGGCGTCATCACTGGCTGGTCTGATCGGGCGGCTAGACCCCCGCCCGCGGCCGTTACTCACGAGCAAGG
CGAGGGGAAGCAGCTGTACTTTATGTGCTTGTGAGTCAATCTCTCTTACGCGAACGCGAACATCTCCGTCTGCTT
CCCCGTCGGCCAGGAAACTCATGCCCACCTCCAGCCCCAGCACCGGATCGGAACCACACGTCGTCAAGGCAGATA
GCGTCGAAATCATCACCGATGCCTCGCAGGTCAACGACGACATGTTCCCGCTGGCCGGCAAGTTCTTCCGTCGCT
TTGACCGCGAGTCGTGCACCTTTGTCTCCAATATACGGGAGCAGTATCCCGACGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail