Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03214
Gene name
Locationscaffold_03:955337..958693
Strand+
Gene length (bp)3356
Transcript length (bp)3216
Coding sequence length (bp)3216
Protein length (aa) 1072

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17405 Nrap_D4 Nrap protein nucleotidyltransferase domain 4 7.5E-57 620 807
PF03813 Nrap Nrap protein domain 1 4.7E-45 142 297
PF17403 Nrap_D2 Nrap protein PAP/OAS-like domain 5.1E-44 301 446
PF17404 Nrap_D3 Nrap protein domain 3 5.6E-41 452 600
PF17407 Nrap_D6 Nrap protein domain 6 3.6E-24 937 1057
PF17406 Nrap_D5 Nrap protein PAP/OAS1-like domain 5 3.1E-14 810 856

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2337 0.9385 0.3698 0.012 0.2509 0.0026 0.0372 0.0125 0.0104 0.008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1244
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1166
Ophiocordyceps australis map64 (Brazil) OphauB2|2618
Ophiocordyceps camponoti-floridani Ophcf2|03214 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4920
Ophiocordyceps kimflemingae Ophio5|5371
Ophiocordyceps subramaniannii Hirsu2|10440

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03214
MESSSKRRKIDHTEAGLRRHSALIDFKASSSTQLSTATAFVLQTDQLLKEARIDHGKTLGDVDGHLFRLKKAIEA
IESHDPLPIGEATARLEARHKLIIPYPDPKPPRDAPYKMAYEKPAQCNVVGSYLSKTMIKTGSDVAIDMVVQMPA
SLFQEKDYNNMRYFYRRAYYIAYIASQLRSQEQDTMKLSFELLNDNPLLPVMVLTPRHPKFDVNGVERKKNPDKK
SRCSSGYNIRLIPCAPDELFPWSKLTPTSSCNRSGEGDANPGRSAATPFYNSTLNAEGTFISYLRLLSHAKNQCA
AFADACILGRIWLQQRGFGGGISKGGFGHFQWSVVLALLLGMGERSGQALLSPSLSCTELFKAMIQFLSTTNFVD
KAFIFGASIGHKSDKTVREEGPVLFDPGRKLNLAFHMTPGSAKLLRLYAKSTADLLADDAADKFHATFIVKADVA
SLNFDALFDIHSNTLSERLSTSADRSSPGWKVSSEVYKILSRAYSERCQLVHIHQGEPRSWPLDVAMPQQPDCIC
VGLIFDPAHMSRQMEHGPPAEDDKKAAAFRQFWGDKAELRRFKDGSILECVEWRGRLAGQIFKEIACFALKRHLK
ITKDEINAREDGFSSMMAFSHLDKEAFDAARRAFSNLERDIRGLTEMPLQIRQLSPISPAARYSSVQPPVLGFHK
DAIEPMDVNLYFEASGRWPENLTAIQQAKMDFLLDIDQRLTTAHKTITTFLGREDRDIGIENLAYLDIIYEDGAA
FRLRIHCDLEETLLQRNATSKALSHSEREASARALDACRWLHTTLPLHTQLIATSCTRMPSLSPSTRLARHWFDC
HKLSGHFRSELIELLVLHVFLHPYPWPVPSRHTLTRARQTPARLPSQTRSAHQLIASPLRRNPIRQFRPRLHPQH
PFQARRLTHDPPRKSRLQTPPPPKPTRRPPALFTPSLHDYDILIHLSPKAARDARCESRAPPLFRNLTAAPLPVR
SDPSDVLAAELERVYADTLVFFRGGGSVLAAIWTPTLPERPVRFRPGLPFNFAEAGDDAVELNRDAVLSEIARVG
GKLISRIERLDDDDKDDGGGE*
Coding >Ophcf2|03214
ATGGAATCGAGCTCGAAGCGTCGCAAGATCGACCACACCGAAGCCGGTCTGCGGCGTCACAGCGCTCTCATTGAC
TTCAAGGCCTCGAGCTCTACCCAGCTGTCGACTGCCACTGCATTTGTCCTTCAGACCGACCAGCTCCTCAAAGAG
GCTCGGATCGACCATGGCAAGACCTTGGGCGACGTCGATGGCCATCTTTTCCGCCTCAAGAAAGCGATCGAAGCA
ATTGAATCTCACGATCCTCTTCCCATTGGCGAGGCAACTGCCCGGCTCGAAGCCAGGCACAAGCTCATCATCCCT
TATCCGGACCCGAAGCCTCCTCGCGATGCACCGTACAAGATGGCCTATGAGAAGCCGGCGCAATGCAATGTCGTT
GGGAGCTATCTCTCCAAGACTATGATTAAGACGGGATCCGACGTCGCCATCGACATGGTCGTCCAGATGCCTGCT
TCGCTGTTCCAGGAAAAGGACTACAACAACATGCGATACTTTTATCGGAGGGCCTACTATATAGCCTACATTGCC
TCGCAACTGCGCAGCCAGGAGCAAGATACCATGAAACTCTCCTTCGAGCTCCTCAACGACAACCCGCTGCTGCCT
GTGATGGTTCTGACGCCTCGCCATCCGAAATTCGACGTCAACGGTGTCGAAAGGAAAAAGAATCCGGATAAGAAG
TCCCGTTGCAGCTCTGGGTACAATATTCGGCTGATACCGTGTGCTCCTGATGAGCTATTTCCCTGGTCAAAGTTG
ACGCCCACGTCAAGCTGCAACCGAAGCGGTGAGGGGGACGCAAACCCGGGTCGTTCAGCAGCGACGCCCTTTTAC
AATTCCACTTTGAATGCGGAGGGGACCTTTATCTCATACCTTCGCCTCTTGTCTCACGCAAAAAACCAGTGTGCC
GCATTTGCCGATGCATGCATCCTCGGCAGGATATGGCTTCAGCAGCGTGGCTTTGGAGGCGGCATATCCAAAGGC
GGCTTTGGCCACTTCCAGTGGTCAGTTGTGCTCGCGCTGCTGTTAGGAATGGGCGAACGCAGCGGCCAGGCTTTG
CTCTCGCCGTCTCTCAGCTGCACAGAGCTGTTCAAAGCCATGATCCAGTTTCTTTCGACGACGAACTTTGTTGAC
AAGGCATTCATATTTGGAGCCTCGATTGGACACAAGAGCGACAAGACCGTTCGAGAGGAAGGTCCTGTTCTCTTC
GATCCGGGTCGAAAACTGAATCTGGCCTTCCACATGACTCCCGGGTCTGCCAAGTTACTACGCCTTTACGCGAAA
TCGACAGCCGATCTTCTCGCCGACGACGCTGCTGATAAATTCCATGCGACATTCATTGTTAAAGCCGACGTTGCG
TCACTGAATTTTGATGCCCTGTTCGACATCCACAGCAACACCTTGTCAGAACGTCTCTCGACCTCGGCCGACAGG
AGCAGTCCGGGGTGGAAGGTCAGCTCAGAGGTCTACAAAATCCTCTCCAGAGCGTATAGTGAGCGTTGTCAGCTC
GTTCATATCCATCAGGGGGAGCCGCGTTCTTGGCCGCTCGATGTTGCTATGCCTCAACAGCCAGACTGTATCTGT
GTCGGACTCATCTTCGACCCGGCGCATATGTCCCGTCAGATGGAGCACGGCCCTCCGGCAGAAGATGACAAAAAA
GCGGCCGCGTTCCGTCAGTTCTGGGGCGATAAGGCGGAGCTGCGGCGCTTCAAGGATGGCAGCATCCTGGAGTGC
GTCGAATGGAGGGGAAGACTCGCGGGACAGATTTTCAAGGAGATTGCTTGCTTTGCGCTGAAACGACATCTGAAG
ATAACCAAGGACGAGATTAACGCAAGAGAAGACGGCTTCTCCTCTATGATGGCTTTCTCACACCTCGACAAGGAG
GCCTTTGACGCAGCCAGAAGGGCATTCTCTAATCTCGAGCGTGACATCCGTGGCCTGACAGAGATGCCGCTCCAG
ATCCGACAATTGTCTCCGATCTCGCCCGCGGCCCGGTATTCATCTGTCCAGCCACCTGTGTTGGGCTTCCACAAG
GACGCCATAGAGCCGATGGATGTCAACCTCTACTTCGAGGCGTCTGGCAGGTGGCCCGAGAACCTGACGGCCATC
CAGCAAGCCAAGATGGACTTTCTCCTCGATATCGATCAGCGTCTGACGACGGCACACAAGACCATCACCACCTTT
CTCGGCCGCGAGGACAGGGACATTGGCATAGAGAACCTCGCTTACCTCGACATCATCTACGAAGACGGCGCCGCC
TTTCGTCTCCGCATCCACTGCGATCTCGAAGAGACTCTCCTGCAGCGCAACGCCACGAGCAAGGCGCTGTCCCAT
AGCGAGCGCGAAGCCTCAGCCCGCGCCCTCGACGCCTGCCGCTGGCTGCACACAACTCTGCCCCTTCATACGCAG
CTGATAGCCACGTCGTGCACGAGAATGCCCTCTCTATCGCCCTCCACCAGACTGGCCAGACACTGGTTCGACTGC
CACAAGCTAAGCGGCCACTTCCGCTCCGAGCTGATCGAGCTCTTGGTCCTTCACGTCTTCCTACATCCCTACCCC
TGGCCAGTCCCCTCCCGGCACACTCTCACCCGAGCACGTCAAACACCAGCTCGACTCCCTTCGCAGACGAGATCC
GCACATCAACTCATCGCCAGCCCTCTTCGTCGCAACCCCATCCGACAATTCCGGCCTCGCCTACACCCGCAACAC
CCCTTCCAAGCTCGTCGCCTCACGCATGACCCGCCTCGCAAAAGCCGCCTGCAAACTCCTCCGCCCCCCAAACCA
ACGCGTCGACCCCCAGCCCTCTTCACCCCCTCCCTCCACGACTACGACATCCTGATCCACCTCTCCCCCAAAGCC
GCCCGCGACGCCAGATGCGAATCCCGCGCCCCCCCTCTCTTCCGCAACCTAACCGCCGCACCGCTCCCCGTCCGC
TCAGACCCGTCGGACGTGCTGGCAGCCGAGCTGGAGCGCGTCTACGCCGACACGCTCGTCTTCTTCCGCGGCGGG
GGCTCCGTCCTCGCCGCCATCTGGACTCCGACCTTACCCGAGCGGCCCGTCCGGTTTCGCCCCGGCTTGCCCTTC
AACTTTGCCGAGGCGGGGGATGACGCCGTTGAGCTGAACCGTGATGCGGTCTTGTCGGAGATTGCGCGTGTCGGC
GGTAAGCTTATTAGCAGAATTGAACGGCTGGACGATGACGACAAGGATGATGGTGGTGGTGAATAG
Transcript >Ophcf2|03214
ATGGAATCGAGCTCGAAGCGTCGCAAGATCGACCACACCGAAGCCGGTCTGCGGCGTCACAGCGCTCTCATTGAC
TTCAAGGCCTCGAGCTCTACCCAGCTGTCGACTGCCACTGCATTTGTCCTTCAGACCGACCAGCTCCTCAAAGAG
GCTCGGATCGACCATGGCAAGACCTTGGGCGACGTCGATGGCCATCTTTTCCGCCTCAAGAAAGCGATCGAAGCA
ATTGAATCTCACGATCCTCTTCCCATTGGCGAGGCAACTGCCCGGCTCGAAGCCAGGCACAAGCTCATCATCCCT
TATCCGGACCCGAAGCCTCCTCGCGATGCACCGTACAAGATGGCCTATGAGAAGCCGGCGCAATGCAATGTCGTT
GGGAGCTATCTCTCCAAGACTATGATTAAGACGGGATCCGACGTCGCCATCGACATGGTCGTCCAGATGCCTGCT
TCGCTGTTCCAGGAAAAGGACTACAACAACATGCGATACTTTTATCGGAGGGCCTACTATATAGCCTACATTGCC
TCGCAACTGCGCAGCCAGGAGCAAGATACCATGAAACTCTCCTTCGAGCTCCTCAACGACAACCCGCTGCTGCCT
GTGATGGTTCTGACGCCTCGCCATCCGAAATTCGACGTCAACGGTGTCGAAAGGAAAAAGAATCCGGATAAGAAG
TCCCGTTGCAGCTCTGGGTACAATATTCGGCTGATACCGTGTGCTCCTGATGAGCTATTTCCCTGGTCAAAGTTG
ACGCCCACGTCAAGCTGCAACCGAAGCGGTGAGGGGGACGCAAACCCGGGTCGTTCAGCAGCGACGCCCTTTTAC
AATTCCACTTTGAATGCGGAGGGGACCTTTATCTCATACCTTCGCCTCTTGTCTCACGCAAAAAACCAGTGTGCC
GCATTTGCCGATGCATGCATCCTCGGCAGGATATGGCTTCAGCAGCGTGGCTTTGGAGGCGGCATATCCAAAGGC
GGCTTTGGCCACTTCCAGTGGTCAGTTGTGCTCGCGCTGCTGTTAGGAATGGGCGAACGCAGCGGCCAGGCTTTG
CTCTCGCCGTCTCTCAGCTGCACAGAGCTGTTCAAAGCCATGATCCAGTTTCTTTCGACGACGAACTTTGTTGAC
AAGGCATTCATATTTGGAGCCTCGATTGGACACAAGAGCGACAAGACCGTTCGAGAGGAAGGTCCTGTTCTCTTC
GATCCGGGTCGAAAACTGAATCTGGCCTTCCACATGACTCCCGGGTCTGCCAAGTTACTACGCCTTTACGCGAAA
TCGACAGCCGATCTTCTCGCCGACGACGCTGCTGATAAATTCCATGCGACATTCATTGTTAAAGCCGACGTTGCG
TCACTGAATTTTGATGCCCTGTTCGACATCCACAGCAACACCTTGTCAGAACGTCTCTCGACCTCGGCCGACAGG
AGCAGTCCGGGGTGGAAGGTCAGCTCAGAGGTCTACAAAATCCTCTCCAGAGCGTATAGTGAGCGTTGTCAGCTC
GTTCATATCCATCAGGGGGAGCCGCGTTCTTGGCCGCTCGATGTTGCTATGCCTCAACAGCCAGACTGTATCTGT
GTCGGACTCATCTTCGACCCGGCGCATATGTCCCGTCAGATGGAGCACGGCCCTCCGGCAGAAGATGACAAAAAA
GCGGCCGCGTTCCGTCAGTTCTGGGGCGATAAGGCGGAGCTGCGGCGCTTCAAGGATGGCAGCATCCTGGAGTGC
GTCGAATGGAGGGGAAGACTCGCGGGACAGATTTTCAAGGAGATTGCTTGCTTTGCGCTGAAACGACATCTGAAG
ATAACCAAGGACGAGATTAACGCAAGAGAAGACGGCTTCTCCTCTATGATGGCTTTCTCACACCTCGACAAGGAG
GCCTTTGACGCAGCCAGAAGGGCATTCTCTAATCTCGAGCGTGACATCCGTGGCCTGACAGAGATGCCGCTCCAG
ATCCGACAATTGTCTCCGATCTCGCCCGCGGCCCGGTATTCATCTGTCCAGCCACCTGTGTTGGGCTTCCACAAG
GACGCCATAGAGCCGATGGATGTCAACCTCTACTTCGAGGCGTCTGGCAGGTGGCCCGAGAACCTGACGGCCATC
CAGCAAGCCAAGATGGACTTTCTCCTCGATATCGATCAGCGTCTGACGACGGCACACAAGACCATCACCACCTTT
CTCGGCCGCGAGGACAGGGACATTGGCATAGAGAACCTCGCTTACCTCGACATCATCTACGAAGACGGCGCCGCC
TTTCGTCTCCGCATCCACTGCGATCTCGAAGAGACTCTCCTGCAGCGCAACGCCACGAGCAAGGCGCTGTCCCAT
AGCGAGCGCGAAGCCTCAGCCCGCGCCCTCGACGCCTGCCGCTGGCTGCACACAACTCTGCCCCTTCATACGCAG
CTGATAGCCACGTCGTGCACGAGAATGCCCTCTCTATCGCCCTCCACCAGACTGGCCAGACACTGGTTCGACTGC
CACAAGCTAAGCGGCCACTTCCGCTCCGAGCTGATCGAGCTCTTGGTCCTTCACGTCTTCCTACATCCCTACCCC
TGGCCAGTCCCCTCCCGGCACACTCTCACCCGAGCACGTCAAACACCAGCTCGACTCCCTTCGCAGACGAGATCC
GCACATCAACTCATCGCCAGCCCTCTTCGTCGCAACCCCATCCGACAATTCCGGCCTCGCCTACACCCGCAACAC
CCCTTCCAAGCTCGTCGCCTCACGCATGACCCGCCTCGCAAAAGCCGCCTGCAAACTCCTCCGCCCCCCAAACCA
ACGCGTCGACCCCCAGCCCTCTTCACCCCCTCCCTCCACGACTACGACATCCTGATCCACCTCTCCCCCAAAGCC
GCCCGCGACGCCAGATGCGAATCCCGCGCCCCCCCTCTCTTCCGCAACCTAACCGCCGCACCGCTCCCCGTCCGC
TCAGACCCGTCGGACGTGCTGGCAGCCGAGCTGGAGCGCGTCTACGCCGACACGCTCGTCTTCTTCCGCGGCGGG
GGCTCCGTCCTCGCCGCCATCTGGACTCCGACCTTACCCGAGCGGCCCGTCCGGTTTCGCCCCGGCTTGCCCTTC
AACTTTGCCGAGGCGGGGGATGACGCCGTTGAGCTGAACCGTGATGCGGTCTTGTCGGAGATTGCGCGTGTCGGC
GGTAAGCTTATTAGCAGAATTGAACGGCTGGACGATGACGACAAGGATGATGGTGGTGGTGAATAG
Gene >Ophcf2|03214
ATGGAATCGAGCTCGAAGCGTCGCAAGATCGACCACACCGAAGCCGGTCTGCGGCGTCACAGCGCTCTCATTGAC
TTCAAGGCCTCGAGCTCTACCCAGCTGTCGACTGCCACTGCATTTGTCCTTCAGACCGACCAGCTCCTCAAAGAG
GCTCGGATCGACCATGGCAAGACCTTGGGCGACGTCGATGGCCATCTTTTCCGCCTCAAGAAAGCGATCGAAGCA
ATTGAATCTCACGATCCTCTTCCCGTATGCCACCCACAGCCATGACAAGCGTTTCTCAAACGGCCGCTAACACAT
GCCCAGATTGGCGAGGCAACTGCCCGGCTCGAAGCCAGGCACAAGCTCATCATCCCTTATCCGGACCCGAAGCCT
CCTCGCGATGCACCGTACAAGATGGCCTATGAGAAGCCGGCGCAATGCAATGTCGTTGGGAGCTATCTCTCCAAG
ACTATGATTAAGACGGGATCCGACGTCGCCATCGACATGGTCGTCCAGATGCCTGCTTCGCTGTTCCAGGAAAAG
GACTACAACAACATGCGATACTTTTATCGGAGGGCCTACTATATAGCCTACATTGCCTCGCAACTGCGCAGCCAG
GAGCAAGATACCATGAAACTCTCCTTCGAGCTCCTCAACGACAACCCGCTGCTGCCTGTGATGGTTCTGACGCCT
CGCCATCCGAAATTCGACGTCAACGGTGTCGAAAGGAAAAAGAATCCGGATAAGAAGTCCCGTTGCAGCTCTGGG
TACAATATTCGGCTGATACCGTGTGCTCCTGATGAGCTATTTCCCTGGTCAAAGTTGACGCCCACGTCAAGCTGC
AACCGAAGCGGTGAGGGGGACGCAAACCCGGGTCGTTCAGCAGCGACGCCCTTTTACAATTCCACTTTGAATGCG
GAGGGGACCTTTATCTCATACCTTCGCCTCTTGTCTCACGCAAAAAACCAGTGTGCCGCATTTGCCGATGCATGC
ATCCTCGGCAGGATATGGCTTCAGCAGCGTGGCTTTGGAGGCGGCATATCCAAAGGCGGCTTTGGCCACTTCCAG
TGGTCAGTTGTGCTCGCGCTGCTGTTAGGAATGGGCGAACGCAGCGGCCAGGCTTTGCTCTCGCCGTCTCTCAGC
TGCACAGAGCTGTTCAAAGCCATGATCCAGTTTCTTTCGACGACGAACTTTGTTGACAAGGCATTCATATTTGGA
GCCTCGATTGGACACAAGAGCGACAAGACCGTTCGAGAGGAAGGTCCTGTTCTCTTCGATCCGGGTCGAAAACTG
AATCTGGCCTTCCACATGACTCCCGGGTCTGCCAAGTTACTACGCCTTTACGCGAAATCGACAGCCGATCTTCTC
GCCGACGACGCTGCTGATAAATTCCATGCGACATTCATTGTTAAAGCCGACGTTGCGTCACTGAATTTTGATGCC
CTGTTCGACATCCACAGCAACACCTTGTCAGAACGTCTCTCGACCTCGGCCGACAGGAGCAGTCCGGGGTGGAAG
GTCAGCTCAGAGGTCTACAAAATCCTCTCCAGAGCGTATAGTGAGCGTTGTCAGCTCGTTCATATCCATCAGGGG
GAGCCGCGTTCTTGGCCGCTCGATGTTGCTATGCCTCAACAGCCAGACTGTATCTGTGTCGGACTCATCTTCGAC
CCGGCGCATATGTCCCGTCAGATGGAGCACGGCCCTCCGGCAGAAGATGACAAAAAAGCGGCCGCGTTCCGTCAG
TTCTGGGGCGATAAGGCGGAGCTGCGGCGCTTCAAGGATGGCAGCATCCTGGAGTGCGTCGAATGGAGGGGAAGA
CTCGCGGGACAGATTTTCAAGGAGATTGCTTGCTTTGCGCTGAAACGACATCTGAAGATAACCAAGGACGAGATT
AACGCAAGAGAAGACGGCTTCTCCTCTATGATGGCTTTCTCACACCTCGACAAGGAGGCCTTTGACGCAGCCAGA
AGGGCATTCTCTAATCTCGAGCGTGACATCCGTGGCCTGACAGAGATGCCGCTCCAGATCCGACAATTGTCTCCG
ATCTCGCCCGCGGCCCGGTATTCATCTGTCCAGCCACCTGTGTTGGGCTTCCACAAGGACGCCATAGAGCCGATG
GATGTCAACCTCTACTTCGAGGCGTCTGGCAGGTGGCCCGAGAACCTGACGGCCATCCAGCAAGCCAAGATGGAC
TTTCTCCTCGATATCGATCAGCGTCTGACGACGGCACACAAGACCATCACCACCTTTCTCGGCCGCGAGGACAGG
GACATTGGCATAGAGAACCTCGCTTACCTCGACATCATCTACGAAGACGGCGCCGCCTTTCGTCTCCGCATCCAC
TGCGATCTCGAAGAGACTCTCCTGCAGCGCAACGCCACGAGCAAGGCGCTGTCCCATAGCGAGCGCGAAGCCTCA
GCCCGCGCCCTCGACGCCTGCCGCTGGCTGCACACAACTCTGCCCCTTCATACGCAGCTGATAGCCACGTCGTGC
ACGAGAATGCCCTCTCTATCGCCCTCCACCAGACTGGCCAGACACTGGTTCGACTGCCACAAGCTAAGCGGCCAC
TTCCGCTCCGAGCTGATCGAGCTCTTGGTCCTTCACGTCTTCCTACATCCCTACCCCTGGCCAGTCCCCTCGTCA
GCCACCACCGGCTTCCTGCGTTTCCTCTTCTTCCTCTCCAGATGGGACTGGCGAGACGAGCCTCTAACCATCGAC
CCAGCCGGCACACTCTCACCCGAGCACGTCAAACACCAGCTCGACTCCCTTCGCAGACGAGATCCGCACATCAAC
TCATCGCCAGCCCTCTTCGTCGCAACCCCATCCGACAATTCCGGCCTCGCCTACACCCGCAACACCCCTTCCAAG
CTCGTCGCCTCACGCATGACCCGCCTCGCAAAAGCCGCCTGCAAACTCCTCCGCCCCCCAAACCAACGCGTCGAC
CCCCAGCCCTCTTCACCCCCTCCCTCCACGACTACGACATCCTGATCCACCTCTCCCCCAAAGCCGCCCGCGACG
CCAGATGCGAATCCCGCGCCCCCCCTCTCTTCCGCAACCTAACCGCCGCACCGCTCCCCGTCCGCTCAGACCCGT
CGGACGTGCTGGCAGCCGAGCTGGAGCGCGTCTACGCCGACACGCTCGTCTTCTTCCGCGGCGGGGGCTCCGTCC
TCGCCGCCATCTGGACTCCGACCTTACCCGAGCGGCCCGTCCGGTTTCGCCCCGGCTTGCCCTTCAACTTTGCCG
AGGCGGGGGATGACGCCGTTGAGCTGAACCGTGATGCGGTCTTGTCGGAGATTGCGCGTGTCGGCGGTAAGCTTA
TTAGCAGAATTGAACGGCTGGACGATGACGACAAGGATGATGGTGGTGGTGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail