Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03212
Gene name
Locationscaffold_03:950661..951553
Strand-
Gene length (bp)892
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10252 PP28 Casein kinase substrate phosphoprotein PP28 3.4E-28 134 218

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4662 0.5501 0.0211 0.159 0.1616 0.0101 0.1551 0.0131 0.0567 0.0044

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2152
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1164
Ophiocordyceps australis map64 (Brazil) OphauB2|2620
Ophiocordyceps camponoti-floridani Ophcf2|03212 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4922
Ophiocordyceps kimflemingae Ophio5|5374
Ophiocordyceps subramaniannii Hirsu2|2631

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03212
MAGGASAAAGARRAGKYNKPTRGGGKHYSRSLQPVDADGNQVSMWSAGSQGRSDEDENDSDSDDSSDEHEGENGA
GSAQPTAADNNRDDRKALKKARKEAAIAKQKARHVEVGDLPSSDDDSSEDANGEDMPANPNHSKAARSMAKGDVD
EITEGVQKMGAPASRREREALEAAAAKERYMKLQAAGKTDEAKADLARLKLIREQRAAEAARRQAEKDEKEEQEK
ARRAEVDARDAKRREVAAGPKKGGKKK*
Coding >Ophcf2|03212
ATGGCTGGTGGCGCTTCCGCAGCCGCCGGCGCTCGTCGTGCCGGCAAATACAACAAACCGACGAGAGGAGGCGGC
AAGCATTATTCACGCAGCCTCCAACCAGTCGACGCCGATGGTAACCAAGTCAGCATGTGGAGCGCAGGCTCTCAG
GGTCGTTCAGACGAGGACGAGAATGATTCTGATTCGGATGACTCGTCCGACGAGCACGAGGGCGAGAACGGCGCA
GGCTCGGCCCAGCCTACTGCCGCCGATAACAACCGAGATGACCGCAAGGCCTTGAAAAAGGCTCGCAAGGAGGCT
GCCATTGCCAAGCAAAAGGCCCGCCACGTTGAGGTTGGCGACCTTCCCTCCAGCGACGACGATAGCAGTGAGGAT
GCCAATGGCGAAGACATGCCCGCGAATCCGAATCATTCCAAGGCGGCGCGGAGCATGGCCAAAGGCGACGTGGAC
GAGATTACCGAAGGCGTCCAGAAGATGGGCGCTCCAGCCAGCCGCCGCGAGAGAGAGGCCTTGGAAGCCGCGGCT
GCTAAGGAGAGATATATGAAGTTGCAGGCAGCAGGCAAGACAGACGAGGCCAAGGCTGATCTGGCCAGGCTCAAG
CTGATCCGCGAGCAGCGGGCGGCTGAAGCTGCCCGAAGACAGGCTGAAAAGGACGAGAAGGAAGAGCAGGAAAAG
GCTCGTCGGGCTGAGGTAGACGCGAGGGATGCCAAAAGGCGCGAGGTAGCGGCTGGTCCCAAGAAAGGAGGCAAG
AAGAAATGA
Transcript >Ophcf2|03212
ATGGCTGGTGGCGCTTCCGCAGCCGCCGGCGCTCGTCGTGCCGGCAAATACAACAAACCGACGAGAGGAGGCGGC
AAGCATTATTCACGCAGCCTCCAACCAGTCGACGCCGATGGTAACCAAGTCAGCATGTGGAGCGCAGGCTCTCAG
GGTCGTTCAGACGAGGACGAGAATGATTCTGATTCGGATGACTCGTCCGACGAGCACGAGGGCGAGAACGGCGCA
GGCTCGGCCCAGCCTACTGCCGCCGATAACAACCGAGATGACCGCAAGGCCTTGAAAAAGGCTCGCAAGGAGGCT
GCCATTGCCAAGCAAAAGGCCCGCCACGTTGAGGTTGGCGACCTTCCCTCCAGCGACGACGATAGCAGTGAGGAT
GCCAATGGCGAAGACATGCCCGCGAATCCGAATCATTCCAAGGCGGCGCGGAGCATGGCCAAAGGCGACGTGGAC
GAGATTACCGAAGGCGTCCAGAAGATGGGCGCTCCAGCCAGCCGCCGCGAGAGAGAGGCCTTGGAAGCCGCGGCT
GCTAAGGAGAGATATATGAAGTTGCAGGCAGCAGGCAAGACAGACGAGGCCAAGGCTGATCTGGCCAGGCTCAAG
CTGATCCGCGAGCAGCGGGCGGCTGAAGCTGCCCGAAGACAGGCTGAAAAGGACGAGAAGGAAGAGCAGGAAAAG
GCTCGTCGGGCTGAGGTAGACGCGAGGGATGCCAAAAGGCGCGAGGTAGCGGCTGGTCCCAAGAAAGGAGGCAAG
AAGAAATGA
Gene >Ophcf2|03212
ATGGCTGGTGGCGCTTCCGCAGCCGCCGGCGCTCGTCGTGCCGGCAAATACAACAAACCGACGAGAGGAGGTCAG
TGATATGGCCTCTATGACACTGTCCATGGCGACTTTGCTGACTTCCCTCGCTCAACTCTCACACAGGCGGCAAGC
ATTATTCACGCAGCCTCCAACCAGTCGACGCCGATGGTAACCAAGTCAGCATGTGGAGCGCAGGCTCTCAGGGTC
GTTCAGACGAGGACGAGAATGATTCTGATTCGGATGACTCGTCCGACGAGCACGAGGGCGAGAACGGCGCAGGCT
CGGCCCAGCCTACTGCCGCCGATAACAACCGAGATGACCGCAAGGCCTTGAAAAAGGCTCGCAAGGAGGCTGCCA
TTGCCAAGCAAAAGGCCCGCCACGTTGAGGTTGGCGACCTTCCCTCCAGCGACGACGATAGCAGTGAGGATGCCA
ATGGCGAAGACATGCCCGCGAATCCGAATCATTCCAAGGCGGCGCGGAGCATGGCCAAAGGCGACGTGGACGAGA
TTACCGAAGGCGTCCAGAAGATGGGCGCTCCAGCCAGCCGCCGCGAGAGAGAGGCCTTGGAAGCCGCGGCTGCTA
AGGAGAGATATATGAAGTTGCAGGCAGCAGGCAAGACAGACGAGGCCAAGGCTGATCTGGCCAGGCTCAAGCTGA
TCCGCGAGCAGCGGGCGGCTGAAGCTGCCCGAAGACAGGTAGGCGCTGTGATCGCTTCGTCTACGGTCACTTGGC
ACGATGCTGACTTGGACCAATCAAGGCTGAAAAGGACGAGAAGGAAGAGCAGGAAAAGGCTCGTCGGGCTGAGGT
AGACGCGAGGGATGCCAAAAGGCGCGAGGTAGCGGCTGGTCCCAAGAAAGGAGGCAAGAAGAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail