Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03211
Gene name
Locationscaffold_03:948084..949940
Strand-
Gene length (bp)1856
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04935 SURF6 Surfeit locus protein 6 1.1E-43 347 535
PF15459 RRP14 60S ribosome biogenesis protein Rrp14 9.1E-15 9 60

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2094 0.8701 0.0759 0.0067 0.0446 0.0071 0.0435 0.0078 0.0189 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2438
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1162
Ophiocordyceps australis map64 (Brazil) OphauB2|2621
Ophiocordyceps camponoti-floridani Ophcf2|03211 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4923
Ophiocordyceps kimflemingae Ophio5|173
Ophiocordyceps subramaniannii Hirsu2|3469

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03211
MTDSSLQDRLRNHAKAFDGLLSLIPAKTYYGQDASLEGNKRTKQSKEEAAAARRGKLDPDSELNRNAKEVMDERA
NNKRKLREMQQQGNEDEENESDGEGHASDSLESIDGIEAEKPGEGMRIKKVSKKQRLQGGDENDESPKSTQRPQK
LSRKEEKRAAKRERKAGKKAEKKAKRKEEPVAEKDDTATAETHVPSTAASKKTKKKKEKAPNDDATPSEPQPLPS
PPTTLDCQATAEAPLSSQSNLSEPQDDDVKQEIPASSDLKAPSIAFDAEQSIPKPTADALAEATSAPTSASSTTG
TASEKCKQIKMPADMTTLRARLAAKIEALRAARKADGPDGKPIRTRQELIEARRAKQAQRKAHKRELRTLAKQEE
ARKREEALASNSPGVGSPAGVDLDENLSFGRVVFGDGTQASHDLSYVLQKGKRKGPSDAKTALLKVQGQKKRLAE
LEPDKRADVADKEAWLTARRRVEGDKIRDDEATLKKAVRRKEAAKKKSKAAWRERSQGIEKAQKERQRKRESNIQ
KRRDDKMLGKAGKKKAAAGKKGKAGRPGFEGSFGVGGRTK*
Coding >Ophcf2|03211
ATGACCGACTCGTCATTGCAGGATCGCTTGAGAAATCACGCCAAGGCCTTTGATGGGCTCTTGAGCTTGATTCCG
GCCAAGACGTACTATGGGCAGGATGCCAGCTTGGAAGGAAATAAAAGAACGAAACAGAGCAAAGAAGAAGCCGCA
GCCGCCCGCAGAGGCAAACTCGACCCAGACAGCGAACTGAACCGTAACGCCAAGGAGGTCATGGACGAGCGAGCC
AACAACAAGCGGAAGCTCCGAGAGATGCAGCAGCAGGGCAACGAGGACGAGGAGAATGAGTCGGATGGCGAGGGC
CACGCAAGCGACTCTTTGGAGTCCATTGACGGCATTGAGGCTGAAAAACCAGGCGAGGGCATGAGGATAAAAAAG
GTGTCCAAGAAACAGAGGCTGCAGGGTGGTGACGAAAATGACGAATCTCCCAAATCCACCCAACGACCGCAGAAA
CTCTCCCGCAAAGAGGAGAAGAGGGCCGCCAAGAGGGAGAGAAAGGCGGGAAAGAAAGCGGAAAAGAAGGCCAAG
AGAAAAGAAGAACCGGTGGCGGAGAAAGATGATACGGCCACTGCGGAAACGCACGTCCCGTCGACGGCGGCGAGC
AAAAAGACGAAGAAGAAGAAAGAAAAGGCCCCCAACGACGATGCCACGCCGTCTGAGCCGCAGCCGCTTCCCTCT
CCCCCGACCACGCTGGACTGCCAGGCAACGGCAGAAGCTCCGCTCTCGTCGCAGAGCAACCTGTCCGAGCCACAA
GACGATGACGTGAAGCAAGAGATCCCGGCTTCCTCCGACTTAAAAGCCCCATCGATCGCATTCGACGCGGAACAG
TCGATTCCGAAACCGACCGCCGACGCCTTGGCTGAGGCCACAAGCGCACCAACGTCGGCGTCGTCCACCACGGGT
ACCGCTTCCGAGAAATGCAAGCAGATCAAGATGCCGGCCGACATGACGACACTGCGGGCACGCCTTGCGGCCAAG
ATCGAAGCTCTTCGCGCAGCTAGAAAGGCCGATGGTCCGGACGGAAAGCCAATCCGCACACGACAGGAGCTCATC
GAGGCCCGACGCGCCAAGCAAGCACAGCGCAAAGCCCACAAGCGAGAGCTCCGCACGCTGGCCAAGCAGGAAGAA
GCACGCAAACGCGAGGAGGCTCTGGCATCCAACTCACCCGGCGTAGGCAGCCCTGCAGGCGTCGATCTTGACGAG
AACCTGTCCTTTGGCCGCGTTGTCTTTGGCGACGGCACACAGGCATCTCACGACCTCAGCTACGTGCTCCAAAAG
GGCAAGCGCAAGGGCCCCTCCGACGCCAAAACGGCGCTGCTCAAGGTCCAAGGCCAGAAGAAGCGACTCGCCGAG
CTCGAGCCGGACAAGCGGGCCGACGTGGCGGACAAGGAGGCGTGGCTCACAGCCCGGAGACGTGTCGAGGGCGAC
AAGATTCGCGACGACGAGGCCACTCTCAAGAAGGCCGTTCGCCGCAAAGAGGCGGCCAAGAAGAAGAGCAAGGCT
GCCTGGCGCGAGCGCTCCCAGGGCATTGAGAAGGCGCAGAAGGAGCGGCAGAGGAAGCGCGAGAGCAACATCCAG
AAGAGGCGCGACGACAAGATGCTCGGTAAGGCGGGCAAGAAGAAGGCTGCTGCTGGGAAGAAGGGCAAGGCTGGC
CGTCCGGGGTTTGAGGGTAGCTTTGGCGTCGGTGGGCGAACCAAGTGA
Transcript >Ophcf2|03211
ATGACCGACTCGTCATTGCAGGATCGCTTGAGAAATCACGCCAAGGCCTTTGATGGGCTCTTGAGCTTGATTCCG
GCCAAGACGTACTATGGGCAGGATGCCAGCTTGGAAGGAAATAAAAGAACGAAACAGAGCAAAGAAGAAGCCGCA
GCCGCCCGCAGAGGCAAACTCGACCCAGACAGCGAACTGAACCGTAACGCCAAGGAGGTCATGGACGAGCGAGCC
AACAACAAGCGGAAGCTCCGAGAGATGCAGCAGCAGGGCAACGAGGACGAGGAGAATGAGTCGGATGGCGAGGGC
CACGCAAGCGACTCTTTGGAGTCCATTGACGGCATTGAGGCTGAAAAACCAGGCGAGGGCATGAGGATAAAAAAG
GTGTCCAAGAAACAGAGGCTGCAGGGTGGTGACGAAAATGACGAATCTCCCAAATCCACCCAACGACCGCAGAAA
CTCTCCCGCAAAGAGGAGAAGAGGGCCGCCAAGAGGGAGAGAAAGGCGGGAAAGAAAGCGGAAAAGAAGGCCAAG
AGAAAAGAAGAACCGGTGGCGGAGAAAGATGATACGGCCACTGCGGAAACGCACGTCCCGTCGACGGCGGCGAGC
AAAAAGACGAAGAAGAAGAAAGAAAAGGCCCCCAACGACGATGCCACGCCGTCTGAGCCGCAGCCGCTTCCCTCT
CCCCCGACCACGCTGGACTGCCAGGCAACGGCAGAAGCTCCGCTCTCGTCGCAGAGCAACCTGTCCGAGCCACAA
GACGATGACGTGAAGCAAGAGATCCCGGCTTCCTCCGACTTAAAAGCCCCATCGATCGCATTCGACGCGGAACAG
TCGATTCCGAAACCGACCGCCGACGCCTTGGCTGAGGCCACAAGCGCACCAACGTCGGCGTCGTCCACCACGGGT
ACCGCTTCCGAGAAATGCAAGCAGATCAAGATGCCGGCCGACATGACGACACTGCGGGCACGCCTTGCGGCCAAG
ATCGAAGCTCTTCGCGCAGCTAGAAAGGCCGATGGTCCGGACGGAAAGCCAATCCGCACACGACAGGAGCTCATC
GAGGCCCGACGCGCCAAGCAAGCACAGCGCAAAGCCCACAAGCGAGAGCTCCGCACGCTGGCCAAGCAGGAAGAA
GCACGCAAACGCGAGGAGGCTCTGGCATCCAACTCACCCGGCGTAGGCAGCCCTGCAGGCGTCGATCTTGACGAG
AACCTGTCCTTTGGCCGCGTTGTCTTTGGCGACGGCACACAGGCATCTCACGACCTCAGCTACGTGCTCCAAAAG
GGCAAGCGCAAGGGCCCCTCCGACGCCAAAACGGCGCTGCTCAAGGTCCAAGGCCAGAAGAAGCGACTCGCCGAG
CTCGAGCCGGACAAGCGGGCCGACGTGGCGGACAAGGAGGCGTGGCTCACAGCCCGGAGACGTGTCGAGGGCGAC
AAGATTCGCGACGACGAGGCCACTCTCAAGAAGGCCGTTCGCCGCAAAGAGGCGGCCAAGAAGAAGAGCAAGGCT
GCCTGGCGCGAGCGCTCCCAGGGCATTGAGAAGGCGCAGAAGGAGCGGCAGAGGAAGCGCGAGAGCAACATCCAG
AAGAGGCGCGACGACAAGATGCTCGGTAAGGCGGGCAAGAAGAAGGCTGCTGCTGGGAAGAAGGGCAAGGCTGGC
CGTCCGGGGTTTGAGGGTAGCTTTGGCGTCGGTGGGCGAACCAAGTGA
Gene >Ophcf2|03211
ATGACCGACTCGTCATTGCAGGTTCGTCGACCTTTGCCTGGCAGAGCGGCAAGACACCAACAACGTGACTGACGA
CTACCAGGATCGCTTGAGAAATCACGCCAAGGCCTTTGATGGGCTCTTGAGCTTGATTCCGGCCAAGACGTACTA
TGGGCAGGATGCCAGCGTATGCAACCCCTGCCTGAGAGAAATCAGCGTCTTCTTCTTGGGGTCCTGATTGGAGTT
CAAGTCCATCCGCAGGGTCGCGACTGACGACATCTTAGTTGGAAGGAAATAAAAGAACGAAACAGAGCAAAGAAG
AAGCCGCAGCCGCCCGCAGAGGCAAACTCGACCCAGACAGCGAACTGAACCGTAACGCCAAGGAGGTCATGGACG
AGCGAGCCAACAACAAGCGGAAGCTCCGAGAGATGCAGCAGCAGGGCAACGAGGACGAGGAGAATGAGTCGGATG
GCGAGGGCCACGCAAGCGACTCTTTGGAGTCCATTGACGGCATTGAGGCTGAAAAACCAGGCGAGGGCATGAGGA
TAAAAAAGGTGTCCAAGAAACAGAGGCTGCAGGGTGGTGACGAAAATGACGAATCTCCCAAATCCACCCAACGAC
CGCAGAAACTCTCCCGCAAAGAGGAGAAGAGGGCCGCCAAGAGGGAGAGAAAGGCGGGAAAGAAAGCGGAAAAGA
AGGCCAAGAGAAAAGAAGAACCGGTGGCGGAGAAAGATGATACGGCCACTGCGGAAACGCACGTCCCGTCGACGG
CGGCGAGCAAAAAGACGAAGAAGAAGAAAGAAAAGGCCCCCAACGACGATGCCACGCCGTCTGAGCCGCAGCCGC
TTCCCTCTCCCCCGACCACGCTGGACTGCCAGGCAACGGCAGAAGCTCCGCTCTCGTCGCAGAGCAACCTGTCCG
AGCCACAAGACGATGACGTGAAGCAAGAGATCCCGGCTTCCTCCGACTTAAAAGCCCCATCGATCGCATTCGACG
CGGAACAGTCGATTCCGAAACCGACCGCCGACGCCTTGGCTGAGGCCACAAGCGCACCAACGTCGGCGTCGTCCA
CCACGGGTACCGCTTCCGAGAAATGCAAGCAGATCAAGATGCCGGCCGACATGACGACACTGCGGGCACGCCTTG
CGGCCAAGATCGAAGCTCTTCGCGCAGCTAGAAAGGCCGATGGTCCGGACGGAAAGCCAATCCGCACACGACAGG
AGCTCATCGAGGCCCGACGCGCCAAGCAAGCACAGCGCAAAGCCCACAAGCGAGAGCTCCGCACGCTGGCCAAGC
AGGAAGAAGCACGCAAACGCGAGGAGGCTCTGGCATCCAACTCACCCGGCGTAGGCAGCCCTGCAGGCGTCGATC
TTGACGAGAACCTGTCCTTTGGCCGCGTTGTCTTTGGCGACGGCACACAGGCATCTCACGACCTCAGCTACGTGC
TCCAAAAGGGCAAGCGCAAGGGCCCCTCCGACGCCAAAACGGCGCTGCTCAAGGTCCAAGGCCAGAAGAAGCGAC
TCGCCGAGCTCGAGCCGGACAAGCGGGCCGACGTGGCGGACAAGGAGGCGTGGCTCACAGCCCGGAGACGTGTCG
AGGGCGACAAGATTCGCGACGACGAGGCCACTCTCAAGAAGGCCGTTCGCCGCAAAGAGGCGGCCAAGAAGAAGA
GCAAGGCTGCCTGGCGCGAGCGCTCCCAGGGCATTGAGAAGGCGCAGAAGGAGCGGCAGAGGAAGCGCGAGAGCA
ACATCCAGAAGAGGCGCGACGACAAGATGCTCGGTAAGGCGGGCAAGAAGAAGGCTGCTGCTGGGAAGAAGGGCA
AGGCTGGCCGTCCGGGGTTTGAGGGTAGCTTTGGCGTCGGTGGGCGAACCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail