Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03210
Gene name
Locationscaffold_03:945913..947162
Strand+
Gene length (bp)1249
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05719 GPP34 Golgi phosphoprotein 3 (GPP34) 1.0E-68 79 303

GO

GO Term Description Terminal node
GO:0070273 phosphatidylinositol-4-phosphate binding Yes
GO:0005543 phospholipid binding No
GO:0035091 phosphatidylinositol binding No
GO:1901981 phosphatidylinositol phosphate binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.619 0.3693 0.0316 0.1886 0.1976 0.004 0.1701 0.4173 0.5654 0.1644

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2440
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1161
Ophiocordyceps australis map64 (Brazil) OphauB2|2622
Ophiocordyceps camponoti-floridani Ophcf2|03210 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4924
Ophiocordyceps kimflemingae Ophio5|172
Ophiocordyceps subramaniannii Hirsu2|3470

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03210
MSSSSGLTRRRGAGGGTGLAPADSETSNAASRSNSATNVRDSAPETSYEKSENGHKIAFDPRDISESAERSKQPK
LTMMEEVLLLGLKDKQGYLSFWNDNISYALRGCIVLELALRGRISMEKDPSRRRFPPADRNIEVIDDTLTGEVLL
DEALKMMKQSEKMSVSSWIDLMSGETWNLMKIGYQLKQVRERLAKGLVDKGILRTEKRNFLLFDMATHPVADGGA
KEEIRRRVRNVLTQRTVVLNNSQFLPESLDFRYLRTVSMVCAAYAANVLENALSTLGHEARERAFAQTDELLADY
SQWPFGKKAVGNGIGANLPQVIAEEISRAKDKELQLEVVAACLSVFTRLDSLL*
Coding >Ophcf2|03210
ATGTCCTCCTCTTCCGGGTTGACACGACGCCGTGGCGCCGGCGGCGGTACCGGCCTCGCCCCGGCCGATAGTGAG
ACCAGCAACGCCGCCTCGAGGTCCAACTCGGCCACCAACGTACGCGACAGCGCCCCCGAGACGAGCTACGAGAAG
AGCGAAAACGGTCACAAGATCGCCTTCGACCCCCGTGACATCAGCGAGAGCGCCGAGCGCAGCAAACAACCCAAG
CTCACCATGATGGAGGAGGTGTTGCTTCTCGGCCTCAAAGACAAGCAGGGCTATCTCTCCTTCTGGAACGACAAC
ATCTCGTACGCCCTTCGTGGCTGCATCGTCCTCGAGCTGGCCCTCCGCGGTCGCATCAGCATGGAAAAGGATCCG
TCCAGACGGCGCTTCCCTCCAGCCGACCGCAACATTGAAGTCATAGACGACACCCTGACCGGCGAGGTGCTTCTC
GACGAGGCTCTCAAGATGATGAAGCAGAGCGAGAAGATGAGCGTCAGCTCCTGGATCGACCTGATGAGCGGCGAG
ACATGGAACCTGATGAAGATCGGCTATCAACTCAAGCAGGTTCGCGAACGGCTGGCCAAGGGTCTCGTCGACAAG
GGCATCTTACGAACTGAGAAGCGCAACTTCCTTCTCTTCGACATGGCCACCCACCCCGTGGCCGATGGCGGCGCA
AAGGAGGAGATCCGTCGCCGGGTGCGGAATGTCTTGACGCAGCGCACTGTCGTCCTCAACAACAGCCAGTTTCTT
CCCGAGTCACTCGACTTTCGCTACCTACGCACAGTCTCCATGGTCTGCGCCGCCTACGCCGCCAACGTGCTCGAG
AACGCCCTGTCGACGCTCGGCCACGAGGCTCGCGAGCGCGCCTTTGCCCAGACGGACGAGCTGCTGGCCGACTAC
AGCCAGTGGCCGTTTGGCAAGAAGGCTGTCGGCAACGGCATTGGCGCCAACCTGCCCCAGGTCATCGCAGAGGAG
ATAAGCCGTGCCAAGGATAAGGAGCTGCAACTCGAGGTTGTCGCCGCCTGTCTCAGCGTCTTCACTCGTCTAGAC
TCTTTGCTATGA
Transcript >Ophcf2|03210
ATGTCCTCCTCTTCCGGGTTGACACGACGCCGTGGCGCCGGCGGCGGTACCGGCCTCGCCCCGGCCGATAGTGAG
ACCAGCAACGCCGCCTCGAGGTCCAACTCGGCCACCAACGTACGCGACAGCGCCCCCGAGACGAGCTACGAGAAG
AGCGAAAACGGTCACAAGATCGCCTTCGACCCCCGTGACATCAGCGAGAGCGCCGAGCGCAGCAAACAACCCAAG
CTCACCATGATGGAGGAGGTGTTGCTTCTCGGCCTCAAAGACAAGCAGGGCTATCTCTCCTTCTGGAACGACAAC
ATCTCGTACGCCCTTCGTGGCTGCATCGTCCTCGAGCTGGCCCTCCGCGGTCGCATCAGCATGGAAAAGGATCCG
TCCAGACGGCGCTTCCCTCCAGCCGACCGCAACATTGAAGTCATAGACGACACCCTGACCGGCGAGGTGCTTCTC
GACGAGGCTCTCAAGATGATGAAGCAGAGCGAGAAGATGAGCGTCAGCTCCTGGATCGACCTGATGAGCGGCGAG
ACATGGAACCTGATGAAGATCGGCTATCAACTCAAGCAGGTTCGCGAACGGCTGGCCAAGGGTCTCGTCGACAAG
GGCATCTTACGAACTGAGAAGCGCAACTTCCTTCTCTTCGACATGGCCACCCACCCCGTGGCCGATGGCGGCGCA
AAGGAGGAGATCCGTCGCCGGGTGCGGAATGTCTTGACGCAGCGCACTGTCGTCCTCAACAACAGCCAGTTTCTT
CCCGAGTCACTCGACTTTCGCTACCTACGCACAGTCTCCATGGTCTGCGCCGCCTACGCCGCCAACGTGCTCGAG
AACGCCCTGTCGACGCTCGGCCACGAGGCTCGCGAGCGCGCCTTTGCCCAGACGGACGAGCTGCTGGCCGACTAC
AGCCAGTGGCCGTTTGGCAAGAAGGCTGTCGGCAACGGCATTGGCGCCAACCTGCCCCAGGTCATCGCAGAGGAG
ATAAGCCGTGCCAAGGATAAGGAGCTGCAACTCGAGGTTGTCGCCGCCTGTCTCAGCGTCTTCACTCGTCTAGAC
TCTTTGCTATGA
Gene >Ophcf2|03210
ATGTCCTCCTCTTCCGGGTTGACACGACGCCGTGGCGCCGGCGGCGGTACCGGCCTCGCCCCGGCCGATAGTGAG
ACCAGCAACGCCGCCTCGAGGTCCAACTCGGCCACCAACGTACGCGACAGCGCCCCCGAGACGAGCTACGAGAAG
AGCGAAAACGGTCACAAGATCGCCTTCGACCCCCGTGACATCAGCGAGAGCGCCGAGCGCAGCAAACAACCCAAG
CTCACCATGATGGAGGAGGTGTTGCTTCTCGGCCTCAAAGACAAGCAGGTTCGCACACCCTCTCTCTTCGTCCCC
GCCGATCTCTCTTGACGAGTTCATCTCGCTTGTAGGGCTATCTCTCCTTCTGGAACGACAACATCTCGTACGCCC
TTCGTGGCTGCATCGTCCTCGAGCTGGCCCTCCGCGGTCGCATCAGCATGGAAAAGGATCCGTCCAGACGGCGCT
TCCCTCCAGCCGACCGCAACATTGAAGTCATAGACGACACCCTGACCGGCGAGGTGCTTCTCGACGAGGCTCTCA
AGATGATGAAGCAGAGCGAGAAGATGAGCGTCAGCTCCTGGATCGACCTGATGAGCGGTTCGTTCCCTAACCCCG
CCCTTGTTCCTTCTTGCTCGCCCGATAGACTGACATATGCCGGACCTAGGCGAGACATGGAACCTGATGAAGATC
GGCTATCAACTCAAGCAGGTTCGCGAACGGCTGGCCAAGGGTCTCGTCGACAAGGGCATCTTACGAACTGAGAAG
CGCAACTTCCTTCTCTTCGACATGGCCACCCACCCCGTGGCCGATGGCGGCGCAAAGGAGGAGATCCGTCGCCGG
GTGCGGAATGTCTTGACGCAGCGCACTGTCGTCCTCAACAACAGCCAGTTTCTTCCCGAGTCACTCGACTTTCGC
TACCTACGCACAGTCTCCATGGTCTGCGCCGCCTACGCCGCCAACGTGCTCGAGAACGCCCTGTCGACGCTCGGC
CACGAGGCTCGCGAGCGCGCCTTTGCCCAGACGGACGAGCTGCTGGCCGACTACAGCCAGTGGCCGTTTGGCAAG
AAGGCTGTCGGCAACGGCATTGGCGCCAACCTGCCCCAGGTCATCGCAGAGGTAGGTCTTGAACCTTTGTAACCT
GTTCCCTTGCGGCCGCTGATATTGCCCCGTCCAGGAGATAAGCCGTGCCAAGGATAAGGAGCTGCAACTCGAGGT
TGTCGCCGCCTGTCTCAGCGTCTTCACTCGTCTAGACTCTTTGCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail