Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03199
Gene name
Locationscaffold_03:911960..914481
Strand-
Gene length (bp)2521
Transcript length (bp)2298
Coding sequence length (bp)2298
Protein length (aa) 766

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04516 CP2 CP2 transcription factor 2.8E-77 230 460

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3136 0.8831 0.109 0.0213 0.0234 0.0004 0.1226 0.0774 0.0534 0.0485

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
CP2

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1498
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5628
Ophiocordyceps australis map64 (Brazil) OphauB2|1823
Ophiocordyceps camponoti-floridani Ophcf2|03199 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|264
Ophiocordyceps kimflemingae Ophio5|491
Ophiocordyceps subramaniannii Hirsu2|11147

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03199
MFRSRTSSQKPGDDLLANFRQQFPEVVSVSSDNTASIISQATTVNNPIVVSQQQVQKECGPHNDHEPFRDHDPTP
RATNEPWRFTPSLLDAGTYSFSSFANPGPGYYTPTPGGANTLFHSQAGDLHAPALSMVPGLGTPLSMPTSGDAMP
PGAAMVDMAGFDGLHAQHFHHFSNPFMTTQAPQQQGLAPSNFVRRGTGYEPMDHDGSPMNSEACDDRAAPPAPTL
HSRDATAAPTGHPLPPSAEKFRFHAALNAPTAMVRQADEIPVTYLNKGQAYSLSISDTSGAMPVQPGTRYRTFVR
ISFEDDEQRQKPGLCWSLWKEGRGTSEAHQRGGKLQAVEYVEAGQPAEGDDKRTRVELETSSFDGFSVVWTPGAH
GVSEVNIAVRFNFLSTDFSHSKGVKGIPVRLCAKTKKLMTSGNSVQTDEDFTAEICFCKVKLFRDHGAERKLSND
VLHVRKSTEKLKQQLAQMESGLKDLGRRKRHGGVTKGSSQLRPGKVPKHKRTWSLSSSTSSAGGGGGRTSMEEDL
QLKLSLLQDMFTSTRPVSVLYLRGEDSDDPDLHPVTLPGDMSPPAKTSGETARDGPNWQARSAQSSAADSMVSPS
PSALSLVSQASAIGGSGGPGRKGLDSRLHGKPSRVPKMDGQGALTGWIEALGVDPSYGPPVDRREKPVACIYVLL
QAGDETEHQCLYRAIYLMKRTLEELNGRIARKWGLDAARIQRTTRLVQGGLEVEMDDDVVRELKEGQDMRLQVDE
MTWQAGTGLVLRLTF*
Coding >Ophcf2|03199
ATGTTCCGCTCGAGGACGAGCTCGCAGAAGCCCGGCGACGATCTTCTGGCCAACTTTCGACAGCAGTTTCCAGAG
GTCGTCTCCGTCAGCTCAGACAATACGGCGTCCATCATCAGCCAGGCCACGACGGTCAATAATCCCATCGTCGTC
AGCCAGCAACAGGTCCAAAAAGAATGCGGTCCCCATAACGATCATGAGCCGTTCCGGGATCACGATCCCACCCCG
CGTGCCACCAACGAGCCATGGAGATTCACGCCCTCGCTCCTCGACGCCGGCACCTACAGCTTTAGCTCCTTCGCC
AACCCGGGTCCCGGCTACTACACTCCCACGCCCGGGGGCGCCAACACCCTGTTTCACTCCCAGGCCGGAGACCTT
CACGCGCCCGCCCTCTCCATGGTGCCCGGCCTGGGCACGCCCTTGTCGATGCCGACCTCGGGCGACGCCATGCCG
CCGGGCGCCGCCATGGTGGATATGGCCGGTTTCGACGGCTTGCACGCTCAACATTTCCATCACTTCAGCAACCCC
TTCATGACGACCCAGGCCCCCCAACAACAGGGGCTGGCGCCGTCCAACTTTGTTCGCCGGGGCACGGGCTACGAA
CCCATGGATCACGACGGCTCACCCATGAACTCGGAGGCCTGCGACGACCGGGCAGCGCCCCCGGCTCCGACTCTG
CACTCGCGGGATGCGACGGCGGCGCCCACGGGCCATCCGCTTCCGCCCTCGGCGGAGAAGTTTCGCTTCCACGCC
GCTCTCAACGCGCCGACGGCCATGGTCAGGCAGGCCGACGAGATCCCGGTCACGTACCTGAATAAGGGCCAGGCT
TACTCGCTGTCCATCTCCGACACCAGCGGCGCCATGCCCGTCCAGCCCGGCACCCGGTACCGGACCTTTGTGCGC
ATCTCGTTCGAGGACGACGAACAGCGTCAGAAGCCCGGACTGTGCTGGAGCTTGTGGAAGGAAGGACGGGGCACC
AGCGAGGCTCACCAGCGGGGAGGCAAGCTGCAGGCTGTCGAGTACGTGGAAGCGGGTCAGCCGGCAGAGGGGGAC
GACAAGAGGACACGGGTCGAGTTGGAGACGTCGTCCTTCGACGGCTTCTCGGTCGTGTGGACCCCCGGTGCACAC
GGCGTGTCCGAGGTCAACATCGCCGTCCGCTTCAACTTCCTCTCGACTGACTTTAGCCATTCCAAGGGCGTCAAG
GGCATACCCGTGAGGCTCTGTGCCAAGACGAAGAAGCTGATGACGTCGGGAAATAGCGTACAGACAGACGAAGAC
TTTACCGCCGAGATCTGCTTCTGCAAGGTCAAGCTGTTTCGGGACCACGGCGCCGAGCGCAAGCTATCCAACGAC
GTGCTGCACGTCAGAAAGTCGACGGAGAAGCTGAAGCAGCAGCTCGCCCAAATGGAGAGCGGCTTGAAGGACCTG
GGAAGGAGGAAGCGGCACGGCGGAGTCACCAAGGGAAGCTCGCAGCTGCGGCCCGGAAAGGTGCCCAAGCACAAG
AGGACGTGGTCCTTGTCGTCGTCGACCAGCTCGGCAGGGGGCGGAGGCGGGCGCACGAGCATGGAGGAAGACCTG
CAGCTCAAGCTCTCGTTGCTGCAAGACATGTTCACCAGTACGAGGCCCGTCAGCGTGCTGTATCTACGAGGAGAG
GACTCGGACGATCCGGATCTGCACCCCGTCACGCTTCCGGGCGACATGTCACCACCGGCCAAGACGAGCGGAGAG
ACGGCACGGGACGGCCCCAACTGGCAGGCCCGCAGCGCGCAGAGCTCGGCGGCGGATTCGATGGTGTCGCCGTCG
CCCAGCGCCCTTTCGCTCGTCTCGCAGGCATCGGCCATCGGGGGCTCAGGGGGACCCGGGCGCAAGGGCCTGGAC
TCGAGGCTGCACGGCAAGCCGTCGAGGGTGCCCAAGATGGACGGACAGGGGGCCCTGACAGGGTGGATCGAGGCG
CTCGGGGTCGATCCGTCGTACGGGCCGCCGGTGGATCGGAGAGAGAAGCCGGTGGCGTGCATTTACGTGCTGCTC
CAGGCCGGAGACGAGACGGAGCATCAGTGCCTGTACCGGGCCATCTACCTCATGAAGCGGACGCTAGAGGAGCTC
AACGGGCGGATCGCGCGCAAATGGGGCCTGGACGCGGCCCGGATCCAACGGACGACACGGCTCGTTCAGGGGGGT
CTGGAGGTCGAGATGGACGATGACGTGGTCCGCGAGCTAAAGGAAGGACAAGACATGAGGCTCCAGGTTGACGAG
ATGACGTGGCAAGCCGGCACGGGGCTGGTGCTTCGGCTTACCTTCTAA
Transcript >Ophcf2|03199
ATGTTCCGCTCGAGGACGAGCTCGCAGAAGCCCGGCGACGATCTTCTGGCCAACTTTCGACAGCAGTTTCCAGAG
GTCGTCTCCGTCAGCTCAGACAATACGGCGTCCATCATCAGCCAGGCCACGACGGTCAATAATCCCATCGTCGTC
AGCCAGCAACAGGTCCAAAAAGAATGCGGTCCCCATAACGATCATGAGCCGTTCCGGGATCACGATCCCACCCCG
CGTGCCACCAACGAGCCATGGAGATTCACGCCCTCGCTCCTCGACGCCGGCACCTACAGCTTTAGCTCCTTCGCC
AACCCGGGTCCCGGCTACTACACTCCCACGCCCGGGGGCGCCAACACCCTGTTTCACTCCCAGGCCGGAGACCTT
CACGCGCCCGCCCTCTCCATGGTGCCCGGCCTGGGCACGCCCTTGTCGATGCCGACCTCGGGCGACGCCATGCCG
CCGGGCGCCGCCATGGTGGATATGGCCGGTTTCGACGGCTTGCACGCTCAACATTTCCATCACTTCAGCAACCCC
TTCATGACGACCCAGGCCCCCCAACAACAGGGGCTGGCGCCGTCCAACTTTGTTCGCCGGGGCACGGGCTACGAA
CCCATGGATCACGACGGCTCACCCATGAACTCGGAGGCCTGCGACGACCGGGCAGCGCCCCCGGCTCCGACTCTG
CACTCGCGGGATGCGACGGCGGCGCCCACGGGCCATCCGCTTCCGCCCTCGGCGGAGAAGTTTCGCTTCCACGCC
GCTCTCAACGCGCCGACGGCCATGGTCAGGCAGGCCGACGAGATCCCGGTCACGTACCTGAATAAGGGCCAGGCT
TACTCGCTGTCCATCTCCGACACCAGCGGCGCCATGCCCGTCCAGCCCGGCACCCGGTACCGGACCTTTGTGCGC
ATCTCGTTCGAGGACGACGAACAGCGTCAGAAGCCCGGACTGTGCTGGAGCTTGTGGAAGGAAGGACGGGGCACC
AGCGAGGCTCACCAGCGGGGAGGCAAGCTGCAGGCTGTCGAGTACGTGGAAGCGGGTCAGCCGGCAGAGGGGGAC
GACAAGAGGACACGGGTCGAGTTGGAGACGTCGTCCTTCGACGGCTTCTCGGTCGTGTGGACCCCCGGTGCACAC
GGCGTGTCCGAGGTCAACATCGCCGTCCGCTTCAACTTCCTCTCGACTGACTTTAGCCATTCCAAGGGCGTCAAG
GGCATACCCGTGAGGCTCTGTGCCAAGACGAAGAAGCTGATGACGTCGGGAAATAGCGTACAGACAGACGAAGAC
TTTACCGCCGAGATCTGCTTCTGCAAGGTCAAGCTGTTTCGGGACCACGGCGCCGAGCGCAAGCTATCCAACGAC
GTGCTGCACGTCAGAAAGTCGACGGAGAAGCTGAAGCAGCAGCTCGCCCAAATGGAGAGCGGCTTGAAGGACCTG
GGAAGGAGGAAGCGGCACGGCGGAGTCACCAAGGGAAGCTCGCAGCTGCGGCCCGGAAAGGTGCCCAAGCACAAG
AGGACGTGGTCCTTGTCGTCGTCGACCAGCTCGGCAGGGGGCGGAGGCGGGCGCACGAGCATGGAGGAAGACCTG
CAGCTCAAGCTCTCGTTGCTGCAAGACATGTTCACCAGTACGAGGCCCGTCAGCGTGCTGTATCTACGAGGAGAG
GACTCGGACGATCCGGATCTGCACCCCGTCACGCTTCCGGGCGACATGTCACCACCGGCCAAGACGAGCGGAGAG
ACGGCACGGGACGGCCCCAACTGGCAGGCCCGCAGCGCGCAGAGCTCGGCGGCGGATTCGATGGTGTCGCCGTCG
CCCAGCGCCCTTTCGCTCGTCTCGCAGGCATCGGCCATCGGGGGCTCAGGGGGACCCGGGCGCAAGGGCCTGGAC
TCGAGGCTGCACGGCAAGCCGTCGAGGGTGCCCAAGATGGACGGACAGGGGGCCCTGACAGGGTGGATCGAGGCG
CTCGGGGTCGATCCGTCGTACGGGCCGCCGGTGGATCGGAGAGAGAAGCCGGTGGCGTGCATTTACGTGCTGCTC
CAGGCCGGAGACGAGACGGAGCATCAGTGCCTGTACCGGGCCATCTACCTCATGAAGCGGACGCTAGAGGAGCTC
AACGGGCGGATCGCGCGCAAATGGGGCCTGGACGCGGCCCGGATCCAACGGACGACACGGCTCGTTCAGGGGGGT
CTGGAGGTCGAGATGGACGATGACGTGGTCCGCGAGCTAAAGGAAGGACAAGACATGAGGCTCCAGGTTGACGAG
ATGACGTGGCAAGCCGGCACGGGGCTGGTGCTTCGGCTTACCTTCTAA
Gene >Ophcf2|03199
ATGTTCCGCTCGAGGTAAGCCTGAAACCGCCACGGCGCATGTTCCCGCGACCTTTACTGACTCCTCGATAGGACG
AGCTCGCAGAAGCCCGGCGACGATCTTCTGGCCAACTTTCGACAGCAGTTTCCAGAGGTCGTCTCCGTCAGCTCA
GACAATACGGCGTCCATCATCAGCCAGGCCACGACGGTCAATAATCCCATCGTCGTCAGCCAGCAACAGGTCCAA
AAAGAATGGTAAGCCGTCCAGCCTCCTCTTTGCGTCGTCTGAGTTCCCTTTGATTTTATCGTCACGGGAAGCGTC
CAAGTGGTCCGGACCTCTTGTCCTGCCGATGCTTTGGAACGTTTGGTACGACAGAGTCTAGTCCCGGGGCTTGTG
GTGCTAATCAGGAGGTCGCTCTAGCGGTCCCCATAACGATCATGAGCCGTTCCGGGATCACGATCCCACCCCGCG
TGCCACCAACGAGCCATGGAGATTCACGCCCTCGCTCCTCGACGCCGGCACCTACAGCTTTAGCTCCTTCGCCAA
CCCGGGTCCCGGCTACTACACTCCCACGCCCGGGGGCGCCAACACCCTGTTTCACTCCCAGGCCGGAGACCTTCA
CGCGCCCGCCCTCTCCATGGTGCCCGGCCTGGGCACGCCCTTGTCGATGCCGACCTCGGGCGACGCCATGCCGCC
GGGCGCCGCCATGGTGGATATGGCCGGTTTCGACGGCTTGCACGCTCAACATTTCCATCACTTCAGCAACCCCTT
CATGACGACCCAGGCCCCCCAACAACAGGGGCTGGCGCCGTCCAACTTTGTTCGCCGGGGCACGGGCTACGAACC
CATGGATCACGACGGCTCACCCATGAACTCGGAGGCCTGCGACGACCGGGCAGCGCCCCCGGCTCCGACTCTGCA
CTCGCGGGATGCGACGGCGGCGCCCACGGGCCATCCGCTTCCGCCCTCGGCGGAGAAGTTTCGCTTCCACGCCGC
TCTCAACGCGCCGACGGCCATGGTCAGGCAGGCCGACGAGATCCCGGTCACGTACCTGAATAAGGGCCAGGCTTA
CTCGCTGTCCATCTCCGACACCAGCGGCGCCATGCCCGTCCAGCCCGGCACCCGGTACCGGACCTTTGTGCGCAT
CTCGTTCGAGGACGACGAACAGCGTCAGAAGCCCGGACTGTGCTGGAGCTTGTGGAAGGAAGGACGGGGCACCAG
CGAGGCTCACCAGCGGGGAGGCAAGCTGCAGGCTGTCGAGTACGTGGAAGCGGGTCAGCCGGCAGAGGGGGACGA
CAAGAGGACACGGGTCGAGTTGGAGACGTCGTCCTTCGACGGCTTCTCGGTCGTGTGGACCCCCGGTGCACACGG
CGTGTCCGAGGTCAACATCGCCGTCCGCTTCAACTTCCTCTCGACTGACTTTAGCCATTCCAAGGGCGTCAAGGG
CATACCCGTGAGGCTCTGTGCCAAGACGAAGAAGCTGATGACGTCGGGAAATAGCGTACAGACAGACGAAGACTT
TACCGCCGAGATCTGCTTCTGCAAGGTCAAGCTGTTTCGGGACCACGGCGCCGAGCGCAAGCTATCCAACGACGT
GCTGCACGTCAGAAAGTCGACGGAGAAGCTGAAGCAGCAGCTCGCCCAAATGGAGAGCGGCTTGAAGGACCTGGG
AAGGAGGAAGCGGCACGGCGGAGTCACCAAGGGAAGCTCGCAGCTGCGGCCCGGAAAGGTGCCCAAGCACAAGAG
GACGTGGTCCTTGTCGTCGTCGACCAGCTCGGCAGGGGGCGGAGGCGGGCGCACGAGCATGGAGGAAGACCTGCA
GCTCAAGCTCTCGTTGCTGCAAGACATGTTCACCAGTACGAGGCCCGTCAGCGTGCTGTATCTACGAGGAGAGGA
CTCGGACGATCCGGATCTGCACCCCGTCACGCTTCCGGGCGACATGTCACCACCGGCCAAGACGAGCGGAGAGAC
GGCACGGGACGGCCCCAACTGGCAGGCCCGCAGCGCGCAGAGCTCGGCGGCGGATTCGATGGTGTCGCCGTCGCC
CAGCGCCCTTTCGCTCGTCTCGCAGGCATCGGCCATCGGGGGCTCAGGGGGACCCGGGCGCAAGGGCCTGGACTC
GAGGCTGCACGGCAAGCCGTCGAGGGTGCCCAAGATGGACGGACAGGGGGCCCTGACAGGGTGGATCGAGGCGCT
CGGGGTCGATCCGTCGTACGGGCCGCCGGTGGATCGGAGAGAGAAGCCGGTGGCGTGCATTTACGTGCTGCTCCA
GGCCGGAGACGAGACGGAGCATCAGTGCCTGTACCGGGCCATCTACCTCATGAAGCGGACGCTAGAGGAGCTCAA
CGGGCGGATCGCGCGCAAATGGGGCCTGGACGCGGCCCGGATCCAACGGACGACACGGCTCGTTCAGGGGGGTCT
GGAGGTCGAGATGGACGATGACGTGGTCCGCGAGCTAAAGGAAGGACAAGACATGAGGCTCCAGGTTGACGAGAT
GACGTGGCAAGCCGGCACGGGGCTGGTGCTTCGGCTTACCTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail