Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03196
Gene name
Locationscaffold_03:904134..905203
Strand-
Gene length (bp)1069
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1759 0.1713 0.1389 0.4853 0.1496 0.0225 0.6343 0.6323 0.3701 0.0045

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 44 63 19
3 106 128 22
4 160 182 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3632
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|413
Ophiocordyceps australis map64 (Brazil) OphauB2|1829
Ophiocordyceps camponoti-floridani Ophcf2|03196 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6228
Ophiocordyceps kimflemingae Ophio5|403
Ophiocordyceps subramaniannii Hirsu2|7014

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03196
MPTCPVQGNADLYGLGIRIGLYIQMITVQLSGVLSASFRVEDHIGQGTIIFVASTVIILVRLINASISSATSADD
DAALDAVEVFPVLTLLLVQTGVCRVSSRNRLAMLVWVAELVGLAALYNYFWWRGMDMLPRSCPDDKAFFFARVSI
WGWYRSLNKAFGVFAAIGVAFTAVAYCGSAIYELVRWILYLVVRQNDDSSSGGGGGSDGNSVKQKPSPAIGSIDL
LANVGAIVYVEVSLRWNNITGVHSIDSPGQFMPLVIALGQFLSVFYSAAKQLLVMNANEDFVGEEEDNAAECNHV
RDDKTLPLVQAQHATI*
Coding >Ophcf2|03196
ATGCCCACTTGTCCCGTCCAAGGAAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGGCTGTACATCCAGATG
ATAACAGTACAGCTCTCGGGCGTCCTCAGCGCCAGCTTCCGGGTGGAAGACCACATCGGTCAAGGAACCATCATC
TTCGTCGCCTCAACCGTCATAATTCTAGTACGACTCATCAACGCCAGCATCAGCAGCGCGACATCCGCCGACGAC
GACGCCGCCCTCGACGCCGTGGAAGTCTTCCCTGTCTTGACCCTTTTGCTCGTTCAGACGGGTGTGTGCCGCGTC
TCATCGCGGAACCGGCTGGCCATGCTCGTTTGGGTCGCTGAGCTCGTTGGCTTGGCTGCTTTGTATAACTATTTC
TGGTGGCGGGGCATGGACATGCTGCCGCGGTCTTGTCCGGACGATAAGGCCTTCTTCTTTGCTCGTGTCAGCATA
TGGGGTTGGTATCGAAGCCTGAACAAGGCCTTTGGAGTCTTTGCTGCCATCGGAGTCGCCTTCACGGCAGTCGCA
TACTGTGGATCTGCCATCTACGAGCTCGTCCGCTGGATCCTCTACCTCGTCGTGAGACAGAACGATGATAGCAGT
AGCGGCGGCGGCGGCGGCAGTGACGGAAACAGTGTCAAGCAAAAGCCCAGTCCGGCCATCGGATCAATCGATTTG
CTGGCCAACGTCGGCGCAATCGTCTACGTCGAGGTCTCTTTGCGCTGGAACAACATCACAGGCGTGCACTCCATC
GACAGTCCCGGCCAGTTCATGCCCCTGGTCATCGCCCTGGGTCAGTTCCTATCCGTCTTCTATTCGGCCGCCAAG
CAGCTGCTGGTGATGAACGCCAACGAAGACTTCGTCGGAGAGGAAGAGGATAATGCAGCCGAGTGCAACCACGTC
CGTGATGACAAGACGCTGCCTCTCGTACAAGCACAACATGCCACGATATGA
Transcript >Ophcf2|03196
ATGCCCACTTGTCCCGTCCAAGGAAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGGCTGTACATCCAGATG
ATAACAGTACAGCTCTCGGGCGTCCTCAGCGCCAGCTTCCGGGTGGAAGACCACATCGGTCAAGGAACCATCATC
TTCGTCGCCTCAACCGTCATAATTCTAGTACGACTCATCAACGCCAGCATCAGCAGCGCGACATCCGCCGACGAC
GACGCCGCCCTCGACGCCGTGGAAGTCTTCCCTGTCTTGACCCTTTTGCTCGTTCAGACGGGTGTGTGCCGCGTC
TCATCGCGGAACCGGCTGGCCATGCTCGTTTGGGTCGCTGAGCTCGTTGGCTTGGCTGCTTTGTATAACTATTTC
TGGTGGCGGGGCATGGACATGCTGCCGCGGTCTTGTCCGGACGATAAGGCCTTCTTCTTTGCTCGTGTCAGCATA
TGGGGTTGGTATCGAAGCCTGAACAAGGCCTTTGGAGTCTTTGCTGCCATCGGAGTCGCCTTCACGGCAGTCGCA
TACTGTGGATCTGCCATCTACGAGCTCGTCCGCTGGATCCTCTACCTCGTCGTGAGACAGAACGATGATAGCAGT
AGCGGCGGCGGCGGCGGCAGTGACGGAAACAGTGTCAAGCAAAAGCCCAGTCCGGCCATCGGATCAATCGATTTG
CTGGCCAACGTCGGCGCAATCGTCTACGTCGAGGTCTCTTTGCGCTGGAACAACATCACAGGCGTGCACTCCATC
GACAGTCCCGGCCAGTTCATGCCCCTGGTCATCGCCCTGGGTCAGTTCCTATCCGTCTTCTATTCGGCCGCCAAG
CAGCTGCTGGTGATGAACGCCAACGAAGACTTCGTCGGAGAGGAAGAGGATAATGCAGCCGAGTGCAACCACGTC
CGTGATGACAAGACGCTGCCTCTCGTACAAGCACAACATGCCACGATATGA
Gene >Ophcf2|03196
ATGCCCACTTGTCCCGTCCAAGGAAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGGCTGTACATCCAGATG
ATAACAGTACAGCTCTCGGGCGTCCTCAGCGCCAGCTTCCGGGTGGAAGACCACATCGGTCAAGGAACCATCATC
TTCGTCGCCTCAACCGTCATAATTCTAGTACGACTCATCAACGCCAGCATCAGCAGCGCGACATCCGCCGACGAC
GACGCCGCCCTCGACGCCGTGGAAGTCTTCCCTGTCTTGACCCTTTTGCTCGTTCAGACGGGTGTGTGCCGCGTC
TCATCGCGGAACCGGCTGGCCATGCTCGTTTGGGTCGCTGAGCTCGTTGGCTTGGCTGCTTTGTATAACTATTTC
TGGTGGCGGGGCATGGACATGCTGCCGCGGTCTTGTCCGGACGATAAGGCCTTCTTCTTTGCTCGTGTCAGCATA
TGGGGTTGGTATCGAAGCCTGAACAAGGCCTTTGGAGTCTTTGCTGCCATCGGAGTCGCCTTCACGGCAGTCGCA
TACTGTGGATGTGAGTCGCTCACTCGTCTGGAGTAAAGGTGTGAGCTGATATGACCGACCCTCAGCTGCCATCTA
CGAGCTCGTCCGCTGGATCCTCTACCTCGTCGTGAGACAGAACGATGATAGCAGTAGCGGCGGCGGCGGCGGCAG
TGACGGAAACAGTGTCAAGCAAAAGCCCAGTCCGGCCATCGGATCAATCGATTTGCTGGCCAACGTCGGCGCAAT
CGTCTACGTCGAGGTCTCTTTGCGCTGGAACAACATCACAGGCGTGCACTCCATCGACAGTCCCGGCCAGTTCAT
GCCCCTGGTCATCGCCCTGGGTCAGTTCCTATCCGTCTTCTATTCGGCCGCCAAGCAGCTGCTGGTGATGAACGC
CAACGAAGACTTCGTCGGAGAGGAAGAGGGTGAGCGCTCGTGTGAAGTGGACTCATTTCCGAGAGAGCCTCGGCC
TGACAAATGACATATAGATAATGCAGCCGAGTGCAACCACGTCCGTGATGACAAGACGCTGCCTCTCGTACAAGC
ACAACATGCCACGATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail