Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03196
Gene name
Locationscaffold_03:904134..905203
Strand-
Gene length (bp)1069
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 44 63 19
3 106 128 22
4 160 182 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03196
MPTCPVQGNADLYGLGIRIGLYIQMITVQLSGVLSASFRVEDHIGQGTIIFVASTVIILVRLINASISSATSADD
DAALDAVEVFPVLTLLLVQTGVCRVSSRNRLAMLVWVAELVGLAALYNYFWWRGMDMLPRSCPDDKAFFFARVSI
WGWYRSLNKAFGVFAAIGVAFTAVAYCGSAIYELVRWILYLVVRQNDDSSSGGGGGSDGNSVKQKPSPAIGSIDL
LANVGAIVYVEVSLRWNNITGVHSIDSPGQFMPLVIALGQFLSVFYSAAKQLLVMNANEDFVGEEEDNAAECNHV
RDDKTLPLVQAQHATI*
Coding >Ophcf2|03196
ATGCCCACTTGTCCCGTCCAAGGAAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGGCTGTACATCCAGATG
ATAACAGTACAGCTCTCGGGCGTCCTCAGCGCCAGCTTCCGGGTGGAAGACCACATCGGTCAAGGAACCATCATC
TTCGTCGCCTCAACCGTCATAATTCTAGTACGACTCATCAACGCCAGCATCAGCAGCGCGACATCCGCCGACGAC
GACGCCGCCCTCGACGCCGTGGAAGTCTTCCCTGTCTTGACCCTTTTGCTCGTTCAGACGGGTGTGTGCCGCGTC
TCATCGCGGAACCGGCTGGCCATGCTCGTTTGGGTCGCTGAGCTCGTTGGCTTGGCTGCTTTGTATAACTATTTC
TGGTGGCGGGGCATGGACATGCTGCCGCGGTCTTGTCCGGACGATAAGGCCTTCTTCTTTGCTCGTGTCAGCATA
TGGGGTTGGTATCGAAGCCTGAACAAGGCCTTTGGAGTCTTTGCTGCCATCGGAGTCGCCTTCACGGCAGTCGCA
TACTGTGGATCTGCCATCTACGAGCTCGTCCGCTGGATCCTCTACCTCGTCGTGAGACAGAACGATGATAGCAGT
AGCGGCGGCGGCGGCGGCAGTGACGGAAACAGTGTCAAGCAAAAGCCCAGTCCGGCCATCGGATCAATCGATTTG
CTGGCCAACGTCGGCGCAATCGTCTACGTCGAGGTCTCTTTGCGCTGGAACAACATCACAGGCGTGCACTCCATC
GACAGTCCCGGCCAGTTCATGCCCCTGGTCATCGCCCTGGGTCAGTTCCTATCCGTCTTCTATTCGGCCGCCAAG
CAGCTGCTGGTGATGAACGCCAACGAAGACTTCGTCGGAGAGGAAGAGGATAATGCAGCCGAGTGCAACCACGTC
CGTGATGACAAGACGCTGCCTCTCGTACAAGCACAACATGCCACGATATGA
Transcript >Ophcf2|03196
ATGCCCACTTGTCCCGTCCAAGGAAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGGCTGTACATCCAGATG
ATAACAGTACAGCTCTCGGGCGTCCTCAGCGCCAGCTTCCGGGTGGAAGACCACATCGGTCAAGGAACCATCATC
TTCGTCGCCTCAACCGTCATAATTCTAGTACGACTCATCAACGCCAGCATCAGCAGCGCGACATCCGCCGACGAC
GACGCCGCCCTCGACGCCGTGGAAGTCTTCCCTGTCTTGACCCTTTTGCTCGTTCAGACGGGTGTGTGCCGCGTC
TCATCGCGGAACCGGCTGGCCATGCTCGTTTGGGTCGCTGAGCTCGTTGGCTTGGCTGCTTTGTATAACTATTTC
TGGTGGCGGGGCATGGACATGCTGCCGCGGTCTTGTCCGGACGATAAGGCCTTCTTCTTTGCTCGTGTCAGCATA
TGGGGTTGGTATCGAAGCCTGAACAAGGCCTTTGGAGTCTTTGCTGCCATCGGAGTCGCCTTCACGGCAGTCGCA
TACTGTGGATCTGCCATCTACGAGCTCGTCCGCTGGATCCTCTACCTCGTCGTGAGACAGAACGATGATAGCAGT
AGCGGCGGCGGCGGCGGCAGTGACGGAAACAGTGTCAAGCAAAAGCCCAGTCCGGCCATCGGATCAATCGATTTG
CTGGCCAACGTCGGCGCAATCGTCTACGTCGAGGTCTCTTTGCGCTGGAACAACATCACAGGCGTGCACTCCATC
GACAGTCCCGGCCAGTTCATGCCCCTGGTCATCGCCCTGGGTCAGTTCCTATCCGTCTTCTATTCGGCCGCCAAG
CAGCTGCTGGTGATGAACGCCAACGAAGACTTCGTCGGAGAGGAAGAGGATAATGCAGCCGAGTGCAACCACGTC
CGTGATGACAAGACGCTGCCTCTCGTACAAGCACAACATGCCACGATATGA
Gene >Ophcf2|03196
ATGCCCACTTGTCCCGTCCAAGGAAACGCCGACCTCTACGGCCTCGGCATCCGCATCGGGCTGTACATCCAGATG
ATAACAGTACAGCTCTCGGGCGTCCTCAGCGCCAGCTTCCGGGTGGAAGACCACATCGGTCAAGGAACCATCATC
TTCGTCGCCTCAACCGTCATAATTCTAGTACGACTCATCAACGCCAGCATCAGCAGCGCGACATCCGCCGACGAC
GACGCCGCCCTCGACGCCGTGGAAGTCTTCCCTGTCTTGACCCTTTTGCTCGTTCAGACGGGTGTGTGCCGCGTC
TCATCGCGGAACCGGCTGGCCATGCTCGTTTGGGTCGCTGAGCTCGTTGGCTTGGCTGCTTTGTATAACTATTTC
TGGTGGCGGGGCATGGACATGCTGCCGCGGTCTTGTCCGGACGATAAGGCCTTCTTCTTTGCTCGTGTCAGCATA
TGGGGTTGGTATCGAAGCCTGAACAAGGCCTTTGGAGTCTTTGCTGCCATCGGAGTCGCCTTCACGGCAGTCGCA
TACTGTGGATGTGAGTCGCTCACTCGTCTGGAGTAAAGGTGTGAGCTGATATGACCGACCCTCAGCTGCCATCTA
CGAGCTCGTCCGCTGGATCCTCTACCTCGTCGTGAGACAGAACGATGATAGCAGTAGCGGCGGCGGCGGCGGCAG
TGACGGAAACAGTGTCAAGCAAAAGCCCAGTCCGGCCATCGGATCAATCGATTTGCTGGCCAACGTCGGCGCAAT
CGTCTACGTCGAGGTCTCTTTGCGCTGGAACAACATCACAGGCGTGCACTCCATCGACAGTCCCGGCCAGTTCAT
GCCCCTGGTCATCGCCCTGGGTCAGTTCCTATCCGTCTTCTATTCGGCCGCCAAGCAGCTGCTGGTGATGAACGC
CAACGAAGACTTCGTCGGAGAGGAAGAGGGTGAGCGCTCGTGTGAAGTGGACTCATTTCCGAGAGAGCCTCGGCC
TGACAAATGACATATAGATAATGCAGCCGAGTGCAACCACGTCCGTGATGACAAGACGCTGCCTCTCGTACAAGC
ACAACATGCCACGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail