Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03191
Gene name
Locationscaffold_03:889031..894297
Strand-
Gene length (bp)5266
Transcript length (bp)3690
Coding sequence length (bp)3690
Protein length (aa) 1230

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01896 DNA_primase_S DNA primase small subunit 1.8E-61 919 1149
PF00447 HSF_DNA-bind HSF-type DNA-binding 1.2E-29 19 119
PF00072 Response_reg Response regulator receiver domain 1.8E-22 351 463

GO

GO Term Description Terminal node
GO:0003896 DNA primase activity Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0006269 DNA replication, synthesis of RNA primer Yes
GO:0005488 binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016740 transferase activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0140110 transcription regulator activity No
GO:0018130 heterocycle biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:1901363 heterocyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0051252 regulation of RNA metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0019438 aromatic compound biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0065007 biological regulation No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0007165 signal transduction No
GO:0003677 DNA binding No
GO:0003824 catalytic activity No
GO:0090304 nucleic acid metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0003674 molecular_function No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0035556 intracellular signal transduction No
GO:0044238 primary metabolic process No
GO:0097747 RNA polymerase activity No
GO:0003899 DNA-directed 5'-3' RNA polymerase activity No
GO:0032774 RNA biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0031323 regulation of cellular metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3319 0.8636 0.0765 0.0467 0.2106 0.003 0.0997 0.0756 0.0287 0.0017

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1852
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7805
Ophiocordyceps australis map64 (Brazil) OphauB2|1834
Ophiocordyceps camponoti-floridani Ophcf2|03191 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6701
Ophiocordyceps kimflemingae Ophio5|409
Ophiocordyceps subramaniannii Hirsu2|1870

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03191
MSGTEMATPQGVGNNASEFVRKLFRMLEDPSHQDVARWGKDGDTFVVVEGEKFTRSILPKHFKHSNMSSFIRQLN
KYDFHKVKPSSDGDSPTPSGNVLEFKHPYFRADSKDGLDNIRRKAPAPRKAPAAEDFTTSQHVGVISEQLTATQQ
QVQQLQELFAEVSQTNRVLVNEVLALQKMINTQKQAQFEMLNYLSLYSDGRNRGLMGHQPMATNGTGEVDDSSPE
LRRARELLASVTTDSVADRELERLHGTYGSPADSVAMMSSVSMPILHDAINDLSRFPVYPVGQTVGIDPFHSDHI
NKIPYAMPNEAHPSAVSEAPASASVPVPSTPAPTTPMDKSTSLWGPKKPLVFLVEDDPTCAKIGMKFLKSMGCDV
EHAQNGADAYTRINGVGRDHFDMIFMDIIMPRLDGVSATMYIRQQCPSTPIIAMTSNIRPDEVRGYFEHGMNGVL
AKPFTKEGMLKSVKVHMSHLLKNPPAPGPGDGDSSAGYVMGNVPYLNSNSIKFETSTPPPPPPQATSAPSWSPGH
LAQNSVDHCYGLMNGGGGQYGMGRPHYVDATPGGLSDHDSPPEKRQRLSAAQGRETSLVVLKPEVECKRGPACGP
WMANASEKPGRASGTISPRVESILNCGGGGGSGSGSGTFHPLLDRGEWLDIGHGAVRRPRTPALELGVDEGLEHG
GPVTMTSARCDASMMPHSVDLREDDVDHVMAEDDVDGAGKVDDVKPEEDEAVEEKKLAEAGNQVIKDENAVKTEA
DALEALLFDDDDDDDDDDDEFPSSAPVIKEKEEVSVKGEGSSSSSSSSSPSSSQPEALGTTSCSVKASDPEVMRS
FYQRLFPWRQLFHWLNHGPTPTSDFANREFAFTLQNDAYLRYQSYATSDLLRKDVLRLVPSRFEIGPVYSTNPRD
RKTLRGSSAFKPIAKELCFDIDLTDYDGVRTCCDKANICRKCWAFINMAIRVVDVALRQDFGFAHILWVYSGRRG
AHAWVCDKKARALDDQKRRAIAGYLEVVRGGVHGGKKVNVRRPLHPHLCRSLDLLKAHFQHDVLEAQDPWATAEK
AEKLLQLLPDRTLNDSLRRKWEASPDRDSATKWADIDAVAKTGTSKSLDARALLEAKQDVVLEYGYPRLDVEVSK
KLNHLLKSPFVVHPGTGRVCVPIDTSALEDFDPLAVPTVQGLLAEVDAWKEEGGGEGAGKGVADWEKTSLKPYVD
YFRSFVAGLVRDEKGVRVKREREEGLMDF*
Coding >Ophcf2|03191
ATGTCGGGCACCGAAATGGCAACGCCTCAGGGAGTTGGCAACAACGCCAGCGAATTCGTCCGCAAGCTCTTTCGC
ATGCTCGAGGACCCGTCCCATCAGGACGTGGCCAGGTGGGGGAAAGACGGCGACACGTTCGTCGTGGTCGAGGGC
GAGAAATTTACCCGGTCCATATTGCCCAAGCACTTTAAGCACAGCAACATGTCGAGCTTCATCCGGCAGCTCAAC
AAGTATGATTTCCATAAAGTGAAGCCATCGAGCGATGGCGACTCGCCTACTCCCAGCGGCAACGTCCTCGAGTTT
AAGCACCCCTACTTCCGCGCCGATAGCAAGGACGGCCTCGACAATATCCGTCGCAAGGCCCCCGCGCCGAGGAAG
GCCCCGGCGGCCGAGGACTTCACCACCAGCCAGCACGTCGGCGTCATCTCGGAACAGCTCACGGCCACGCAACAG
CAGGTCCAGCAGTTGCAGGAGCTGTTCGCCGAAGTTTCGCAGACTAACAGGGTGCTCGTCAACGAGGTTCTGGCG
CTGCAGAAGATGATCAATACGCAAAAGCAGGCGCAGTTTGAGATGCTAAACTATCTGAGCCTGTACAGCGACGGC
CGCAACCGTGGCCTCATGGGTCATCAGCCCATGGCCACCAACGGCACGGGCGAGGTCGACGACTCGTCGCCCGAA
CTGCGCCGTGCCCGCGAACTCCTCGCCAGCGTCACGACCGACTCGGTCGCGGACCGCGAGCTGGAGCGGCTTCAC
GGCACGTACGGGTCCCCCGCCGACTCGGTCGCCATGATGTCGTCCGTCTCCATGCCCATACTTCACGACGCCATC
AACGACCTCAGCCGCTTTCCCGTATATCCCGTCGGCCAGACGGTTGGCATCGACCCTTTCCACTCGGATCACATC
AACAAGATACCGTATGCCATGCCCAACGAGGCCCATCCATCGGCCGTGTCCGAGGCGCCGGCTTCGGCGTCGGTG
CCGGTCCCGTCGACGCCTGCTCCGACGACGCCCATGGACAAGTCGACGTCTCTCTGGGGACCCAAGAAGCCGCTC
GTCTTCTTGGTCGAAGACGATCCCACGTGCGCCAAGATTGGCATGAAGTTCCTCAAGTCGATGGGCTGCGACGTC
GAGCACGCCCAAAATGGCGCCGACGCCTACACTAGGATAAATGGCGTCGGGCGGGACCACTTTGACATGATCTTC
ATGGACATCATCATGCCGCGGCTCGACGGCGTCTCGGCGACCATGTACATTCGTCAGCAGTGTCCGTCGACGCCC
ATCATCGCCATGACGTCTAACATCCGGCCAGATGAGGTCAGGGGCTACTTTGAGCACGGTATGAATGGCGTGCTG
GCTAAGCCCTTCACCAAGGAGGGCATGCTCAAGTCGGTCAAGGTGCACATGTCACACCTGCTGAAGAATCCGCCA
GCCCCGGGGCCGGGTGACGGTGACAGCTCGGCAGGGTACGTGATGGGTAACGTGCCCTACCTCAACAGCAACTCC
ATCAAATTCGAGACTTCGACGCCGCCTCCACCACCGCCGCAGGCGACGTCTGCGCCCAGCTGGTCGCCGGGGCAC
CTGGCGCAGAACAGCGTAGACCACTGCTATGGTCTGATGAACGGAGGGGGCGGCCAGTACGGCATGGGGCGGCCG
CACTACGTGGACGCGACGCCTGGGGGCTTGTCTGACCACGACAGCCCACCGGAAAAGCGGCAGCGGCTGAGCGCT
GCGCAGGGCAGGGAGACGAGCCTCGTTGTGCTTAAGCCCGAGGTCGAGTGCAAGAGGGGGCCTGCGTGTGGCCCC
TGGATGGCCAACGCTTCCGAAAAGCCGGGACGAGCGAGCGGCACCATATCTCCGCGAGTCGAGAGCATTCTAAAC
TGCGGCGGCGGCGGCGGCAGCGGCAGCGGCAGCGGGACATTCCATCCGCTGCTCGACAGAGGCGAGTGGCTAGAT
ATAGGCCATGGTGCGGTGCGGAGGCCCCGAACCCCGGCCTTGGAGCTGGGAGTCGATGAGGGCCTCGAACATGGC
GGCCCGGTGACGATGACGTCTGCGCGCTGTGATGCCTCGATGATGCCGCATTCGGTCGATTTACGCGAAGATGAT
GTGGATCATGTCATGGCAGAAGATGATGTCGACGGCGCTGGCAAGGTCGACGACGTCAAGCCAGAAGAAGACGAG
GCGGTCGAGGAGAAGAAGCTCGCGGAGGCGGGGAACCAGGTAATCAAGGACGAGAACGCGGTCAAGACCGAGGCC
GATGCTCTTGAAGCGCTCCTCTTCGACGACGACGACGACGACGACGACGACGATGACGAATTCCCCAGCTCGGCC
CCCGTCATCAAAGAAAAAGAAGAAGTGTCCGTCAAAGGAGAAGGCTCCTCCTCCTCCTCCTCCTCCTCCTCGCCA
TCCTCCTCGCAGCCTGAAGCCCTCGGGACAACATCGTGCTCGGTCAAGGCGTCGGATCCGGAGGTGATGCGCAGC
TTCTATCAGCGCCTCTTCCCATGGCGTCAACTCTTCCACTGGCTTAACCACGGTCCGACGCCGACGAGCGACTTT
GCCAACCGCGAGTTTGCCTTTACGCTGCAGAACGACGCCTATCTGCGATACCAGTCCTACGCTACTTCAGACCTG
CTTCGCAAGGACGTGTTGCGCCTCGTCCCCTCACGCTTCGAAATCGGACCCGTCTACTCGACCAACCCTCGCGAC
CGAAAGACGCTGCGCGGCTCATCAGCTTTCAAACCCATCGCCAAAGAGCTCTGCTTCGATATCGACTTGACCGAC
TACGATGGCGTGCGAACTTGTTGCGACAAGGCCAATATCTGCCGCAAGTGCTGGGCTTTTATAAACATGGCGATT
CGGGTGGTTGACGTCGCTCTGCGTCAGGACTTTGGCTTCGCCCATATCCTTTGGGTCTACTCGGGTCGCAGAGGT
GCTCACGCTTGGGTGTGCGATAAGAAGGCTCGCGCCCTGGACGATCAGAAGAGGAGGGCTATTGCTGGATACCTC
GAAGTCGTCAGGGGGGGCGTCCACGGTGGCAAAAAAGTCAACGTTCGCCGTCCGCTGCATCCTCACCTCTGCCGC
AGCCTTGACCTGCTGAAAGCTCACTTCCAGCACGACGTCCTCGAAGCACAAGATCCCTGGGCAACGGCCGAGAAA
GCCGAGAAGCTTCTCCAGCTCCTCCCGGACCGCACGCTCAACGACTCGCTACGACGCAAGTGGGAGGCATCACCA
GACCGCGACTCGGCCACCAAATGGGCCGACATCGACGCCGTGGCCAAGACGGGCACTAGCAAGAGCCTCGACGCT
CGCGCCCTCCTCGAGGCCAAGCAGGACGTCGTCCTAGAATACGGCTACCCGCGGCTAGACGTCGAGGTCAGCAAG
AAGCTCAACCATCTTCTCAAGAGCCCCTTTGTCGTCCACCCGGGCACAGGCCGCGTGTGCGTTCCCATCGACACG
TCCGCACTTGAAGACTTTGATCCTCTCGCTGTGCCGACTGTTCAGGGCTTGCTGGCTGAGGTTGATGCCTGGAAA
GAGGAAGGGGGAGGGGAAGGGGCCGGCAAGGGTGTTGCTGACTGGGAGAAGACGAGCCTTAAGCCGTATGTTGAC
TACTTTAGGTCTTTTGTGGCTGGCTTGGTGAGGGACGAGAAGGGGGTGAGGGTCAAGCGGGAGCGAGAGGAGGGT
TTGATGGATTTTTGA
Transcript >Ophcf2|03191
ATGTCGGGCACCGAAATGGCAACGCCTCAGGGAGTTGGCAACAACGCCAGCGAATTCGTCCGCAAGCTCTTTCGC
ATGCTCGAGGACCCGTCCCATCAGGACGTGGCCAGGTGGGGGAAAGACGGCGACACGTTCGTCGTGGTCGAGGGC
GAGAAATTTACCCGGTCCATATTGCCCAAGCACTTTAAGCACAGCAACATGTCGAGCTTCATCCGGCAGCTCAAC
AAGTATGATTTCCATAAAGTGAAGCCATCGAGCGATGGCGACTCGCCTACTCCCAGCGGCAACGTCCTCGAGTTT
AAGCACCCCTACTTCCGCGCCGATAGCAAGGACGGCCTCGACAATATCCGTCGCAAGGCCCCCGCGCCGAGGAAG
GCCCCGGCGGCCGAGGACTTCACCACCAGCCAGCACGTCGGCGTCATCTCGGAACAGCTCACGGCCACGCAACAG
CAGGTCCAGCAGTTGCAGGAGCTGTTCGCCGAAGTTTCGCAGACTAACAGGGTGCTCGTCAACGAGGTTCTGGCG
CTGCAGAAGATGATCAATACGCAAAAGCAGGCGCAGTTTGAGATGCTAAACTATCTGAGCCTGTACAGCGACGGC
CGCAACCGTGGCCTCATGGGTCATCAGCCCATGGCCACCAACGGCACGGGCGAGGTCGACGACTCGTCGCCCGAA
CTGCGCCGTGCCCGCGAACTCCTCGCCAGCGTCACGACCGACTCGGTCGCGGACCGCGAGCTGGAGCGGCTTCAC
GGCACGTACGGGTCCCCCGCCGACTCGGTCGCCATGATGTCGTCCGTCTCCATGCCCATACTTCACGACGCCATC
AACGACCTCAGCCGCTTTCCCGTATATCCCGTCGGCCAGACGGTTGGCATCGACCCTTTCCACTCGGATCACATC
AACAAGATACCGTATGCCATGCCCAACGAGGCCCATCCATCGGCCGTGTCCGAGGCGCCGGCTTCGGCGTCGGTG
CCGGTCCCGTCGACGCCTGCTCCGACGACGCCCATGGACAAGTCGACGTCTCTCTGGGGACCCAAGAAGCCGCTC
GTCTTCTTGGTCGAAGACGATCCCACGTGCGCCAAGATTGGCATGAAGTTCCTCAAGTCGATGGGCTGCGACGTC
GAGCACGCCCAAAATGGCGCCGACGCCTACACTAGGATAAATGGCGTCGGGCGGGACCACTTTGACATGATCTTC
ATGGACATCATCATGCCGCGGCTCGACGGCGTCTCGGCGACCATGTACATTCGTCAGCAGTGTCCGTCGACGCCC
ATCATCGCCATGACGTCTAACATCCGGCCAGATGAGGTCAGGGGCTACTTTGAGCACGGTATGAATGGCGTGCTG
GCTAAGCCCTTCACCAAGGAGGGCATGCTCAAGTCGGTCAAGGTGCACATGTCACACCTGCTGAAGAATCCGCCA
GCCCCGGGGCCGGGTGACGGTGACAGCTCGGCAGGGTACGTGATGGGTAACGTGCCCTACCTCAACAGCAACTCC
ATCAAATTCGAGACTTCGACGCCGCCTCCACCACCGCCGCAGGCGACGTCTGCGCCCAGCTGGTCGCCGGGGCAC
CTGGCGCAGAACAGCGTAGACCACTGCTATGGTCTGATGAACGGAGGGGGCGGCCAGTACGGCATGGGGCGGCCG
CACTACGTGGACGCGACGCCTGGGGGCTTGTCTGACCACGACAGCCCACCGGAAAAGCGGCAGCGGCTGAGCGCT
GCGCAGGGCAGGGAGACGAGCCTCGTTGTGCTTAAGCCCGAGGTCGAGTGCAAGAGGGGGCCTGCGTGTGGCCCC
TGGATGGCCAACGCTTCCGAAAAGCCGGGACGAGCGAGCGGCACCATATCTCCGCGAGTCGAGAGCATTCTAAAC
TGCGGCGGCGGCGGCGGCAGCGGCAGCGGCAGCGGGACATTCCATCCGCTGCTCGACAGAGGCGAGTGGCTAGAT
ATAGGCCATGGTGCGGTGCGGAGGCCCCGAACCCCGGCCTTGGAGCTGGGAGTCGATGAGGGCCTCGAACATGGC
GGCCCGGTGACGATGACGTCTGCGCGCTGTGATGCCTCGATGATGCCGCATTCGGTCGATTTACGCGAAGATGAT
GTGGATCATGTCATGGCAGAAGATGATGTCGACGGCGCTGGCAAGGTCGACGACGTCAAGCCAGAAGAAGACGAG
GCGGTCGAGGAGAAGAAGCTCGCGGAGGCGGGGAACCAGGTAATCAAGGACGAGAACGCGGTCAAGACCGAGGCC
GATGCTCTTGAAGCGCTCCTCTTCGACGACGACGACGACGACGACGACGACGATGACGAATTCCCCAGCTCGGCC
CCCGTCATCAAAGAAAAAGAAGAAGTGTCCGTCAAAGGAGAAGGCTCCTCCTCCTCCTCCTCCTCCTCCTCGCCA
TCCTCCTCGCAGCCTGAAGCCCTCGGGACAACATCGTGCTCGGTCAAGGCGTCGGATCCGGAGGTGATGCGCAGC
TTCTATCAGCGCCTCTTCCCATGGCGTCAACTCTTCCACTGGCTTAACCACGGTCCGACGCCGACGAGCGACTTT
GCCAACCGCGAGTTTGCCTTTACGCTGCAGAACGACGCCTATCTGCGATACCAGTCCTACGCTACTTCAGACCTG
CTTCGCAAGGACGTGTTGCGCCTCGTCCCCTCACGCTTCGAAATCGGACCCGTCTACTCGACCAACCCTCGCGAC
CGAAAGACGCTGCGCGGCTCATCAGCTTTCAAACCCATCGCCAAAGAGCTCTGCTTCGATATCGACTTGACCGAC
TACGATGGCGTGCGAACTTGTTGCGACAAGGCCAATATCTGCCGCAAGTGCTGGGCTTTTATAAACATGGCGATT
CGGGTGGTTGACGTCGCTCTGCGTCAGGACTTTGGCTTCGCCCATATCCTTTGGGTCTACTCGGGTCGCAGAGGT
GCTCACGCTTGGGTGTGCGATAAGAAGGCTCGCGCCCTGGACGATCAGAAGAGGAGGGCTATTGCTGGATACCTC
GAAGTCGTCAGGGGGGGCGTCCACGGTGGCAAAAAAGTCAACGTTCGCCGTCCGCTGCATCCTCACCTCTGCCGC
AGCCTTGACCTGCTGAAAGCTCACTTCCAGCACGACGTCCTCGAAGCACAAGATCCCTGGGCAACGGCCGAGAAA
GCCGAGAAGCTTCTCCAGCTCCTCCCGGACCGCACGCTCAACGACTCGCTACGACGCAAGTGGGAGGCATCACCA
GACCGCGACTCGGCCACCAAATGGGCCGACATCGACGCCGTGGCCAAGACGGGCACTAGCAAGAGCCTCGACGCT
CGCGCCCTCCTCGAGGCCAAGCAGGACGTCGTCCTAGAATACGGCTACCCGCGGCTAGACGTCGAGGTCAGCAAG
AAGCTCAACCATCTTCTCAAGAGCCCCTTTGTCGTCCACCCGGGCACAGGCCGCGTGTGCGTTCCCATCGACACG
TCCGCACTTGAAGACTTTGATCCTCTCGCTGTGCCGACTGTTCAGGGCTTGCTGGCTGAGGTTGATGCCTGGAAA
GAGGAAGGGGGAGGGGAAGGGGCCGGCAAGGGTGTTGCTGACTGGGAGAAGACGAGCCTTAAGCCGTATGTTGAC
TACTTTAGGTCTTTTGTGGCTGGCTTGGTGAGGGACGAGAAGGGGGTGAGGGTCAAGCGGGAGCGAGAGGAGGGT
TTGATGGATTTTTGA
Gene >Ophcf2|03191
ATGTCGGGCACCGAAATGGCAACGCCTCAGGGAGTTGGCAACAACGCCAGCGAATTCGTGAGTACGCCTTGGCCA
TTATGTGTCCTGCGCTGACCATGTCCAGGTCCGCAAGCTCTTTCGGTATGCCGCCTGCCGCCCTCCCGGGACCGC
CCGGGCCACTGACACATGGTTCCAGCATGCTCGAGGACCCGTCCCATCAGGACGTGGCCAGGTGGGGGAAAGACG
GCGACACGTTCGTCGTGGTCGAGGTGCGTGTCCTTGTTGTTCCGTCGTGGCCGCGCTGACGGCTGCCACATGACC
AGGGCGAGAAATTTACCCGGTCCATATTGCCCAAGCACTTTAAGCACAGCAACATGTCGAGCTTCATCCGGCAGC
TCAACAAGTATGATTTCCATAAAGTGAAGCCATCGAGCGATGGCGACTCGCCTACTCCCAGCGGCAACGTGAGAG
ACTCGGTCTCAGTCGACTTGATGGAGCATGGCCAGGCTGACGAGAGCCACCTTGGCAGGTCCTCGAGTTTAAGCA
CCCCTACTTCCGCGCCGATAGCAAGGACGGCCTCGACAATATCCGTCGCAAGGCCCCCGCGCCGAGGAAGGCCCC
GGCGGCCGAGGACTTCACCACCAGCCAGCACGTCGGCGTCATCTCGGAACAGCTCACGGCCACGCAACAGCAGGT
CCAGCAGTTGCAGGAGCTGTTCGCCGAAGTTTCGCAGACTAACAGGGTGCTCGTCAACGAGGTTCTGGCGCTGCA
GAAGATGATCAATACGCAAAAGCAGGCGCAGTTTGAGATGCTAAACTATCTGAGCCTGTACAGCGACGGCCGCAA
CCGTGGCCTCATGGGTCATCAGCCCATGGCCACCAACGGCACGGGCGAGGTCGACGACTCGTCGCCCGAACTGCG
CCGTGCCCGCGAACTCCTCGCCAGCGTCACGACCGACTCGGTCGCGGACCGCGAGCTGGAGCGGCTTCACGGCAC
GTACGGGTCCCCCGCCGACTCGGTCGCCATGATGTCGTCCGTCTCCATGCCCATACTTCACGACGCCATCAACGA
CCTCAGCCGCTTTCCCGTATATCCCGTCGGCCAGACGGTTGGCATCGACCCTTTCCACTCGGATCACATCAACAA
GATACCGTATGCCATGCCCAACGAGGCCCATCCATCGGCCGTGTCCGAGGCGCCGGCTTCGGCGTCGGTGCCGGT
CCCGTCGACGCCTGCTCCGACGACGCCCATGGACAAGTCGACGTCTCTCTGGGGACCCAAGAAGCCGCTCGTCTT
CTTGGTCGAAGACGATCCCACGTGCGCCAAGATTGGCATGAAGTTCCTCAAGTCGATGGGCTGCGACGTCGAGCA
CGCCGTGAGTCGCCTGGCGCCGGCCATGATCGGGGGGGGGGGCCGGGGACAGAGGGTTTCTGACGTTGTCTTGAC
CAGCAAAATGGCGCCGACGCCTACACTAGGATAAATGGCGTCGGGCGGGACCACTTTGACATGATCTTCATGGAC
ATCATCATGCCGCGGCTCGACGGCGTCTCGGCGACCATGTACATTCGTCAGCAGTGTCCGTCGACGCCCATCATC
GCCATGACGTCTAACATCCGGCCAGATGAGGTCAGGGGCTACTTTGAGCACGGTAGGCGTATCGGTGGTGACCTC
TGTTGACGTTTTGGGACCTGCTGCTGACAGGGTCGCAGGTATGAATGGCGTGCTGGCTAAGCCCTTCACCAAGGA
GGGCATGCTCAAGTCGGTCAAGGTGCACATGTCACACCTGCTGAAGAATCCGCCAGCCCCGGGGCCGGGTGACGG
TGACAGCTCGGCAGGGTACGTGATGGGTAACGTGCCCTACCTCAACAGCAACTCCATCAAATTCGAGACTTCGAC
GCCGCCTCCACCACCGCCGCAGGCGACGTCTGCGCCCAGCTGGTCGCCGGGGCACCTGGCGCAGAACAGCGTAGA
CCACTGCTATGGTCTGATGAACGGAGGGGGCGGCCAGTACGGCATGGGGCGGCCGCACTACGTGGACGCGACGCC
TGGGGGCTTGTCTGACCACGACAGCCCACCGGAAAAGCGGCAGCGGCTGAGCGCTGCGCAGGGTAATTTCGGCTG
AGAGGAGGCGAACGACGGCCGAGGCCGAGGCCGAGTAACGCAAGGCAGGGAGACGAGCCTCGTTGTGCTTAAGCC
CGAGGTCGAGTGCAAGAGGGGGCCTGCGTGTGGCCCCTGGATGGCCAACGCTTCCGAAAAGCCGGGACGAGCGAG
CGGCACCATATCTCCGCGAGTCGAGAGCATTCTAAGTATGACCAGACTCGGGAGAATGGGAGAACGCAGAGGAGA
GGCGGTGGGACGGAGCCAGACTGCGGCGGCGGCGGCGGCAGCGGCAGCGGCAGCGGGACATTCCATCCGCTGCTC
GACAGAGGCGAGTGGCTAGATATAGGCCATGGTGCGGTGCGGAGGCCCCGAACCCCGGCCTTGGAGCTGGGAGTC
GATGAGGGCCTCGAACATGGCGGCCCGGTGACGATGACGTCTGCGCGCTGTGATGCCTCGGTAACTGACCAGGGT
CGGGGGTTGGGGAAGGGTAAAGGTGGAAGAGTGAATGGGGTTTTGCTCCTGGTGAAAATCTTGAATAAGAGGCGA
ACGAAGCGAGGTGACTACTCGACGGTGATGGCTGGCGTTGCTTGTCATTTGAGCGTGAGATGGTTACTTCTGTTA
CCTATGTCATGGAAACGCGGATGAGTGAGAATGTGTGAGTTGTATAAAGCGGAGAGTGAGGCACAGGAGCTGAGG
AGTAACTTGTAAGTATTAAGTAAGTAGGAGAAGCCGTGTAGGAGACGAGACGAGATATAGGCCGTCGACGGAAAG
GATAGAGTTCTCTCGGCTGCAACACGACAGCGGCATCTGAGCGGCCGAGACTCGGAGCAATTCCGCCTCGACGAT
TATGCGCCCAGTAGGGATTCCACGACGCGCTGACTATCACATGGGGGTAGCTGTCGGACGGGCGCCCAGACCTGA
GCTGTAACACGGGCGAGTCCTCGCTGCCGAGTCTAGGCCGTTCCTAAGTGACTGGAGGGAGGGGGAGCGGCGGTC
GGCCGCATTAGGGAGCACTCAAGGTTTGCTTCGTCCCATTGTGATCCTATTTAGGGGTGTTTCTTTGATTGCTCA
TGCTTGTGGTGGGAAGGTTCGTTGTTGTTTCGGCTGCTTGTAGGCTCCTCGCCTGGTCTTTGCGGTTGGGGCCGG
AAGCTGGAGGTTGTCGGCATGGAGAGGGAGTTCCGAGGCTGGGAGTCTCCCGGGTAGGTAGGTTGATTCGGGGGG
TGGTGGATCCGGAGGGAGGGTGGTGGATCCGTTGGGTGGATCCGTGGGATGGGTCCCGGCTCGGTACGGATACGA
GGCACGACATGACACGAGCCACCGACGACGCGTCTAATCGCGTGCACAACAGCCTCTTTACGCGTCTCCTTCCCC
TTTCAGAGGGTTCTAGACTTTGCGACTCTTTCTGGCATCATTGAGGCGTGAGACGACGCGAGTTCCTGTCAGATG
ATGCCGCATTCGGTCGATTTACGCGAAGATGATGTGGATCATGTCATGGCAGAAGATGATGTCGACGGCGCTGGC
AAGGTCGACGACGTCAAGCCAGAAGAAGACGAGGCGGTCGAGGAGAAGAAGCTCGCGGAGGCGGGGAACCAGGTA
ATCAAGGACGAGAACGCGGTCAAGACCGAGGCCGATGCTCTTGAAGCGCTCCTCTTCGACGACGACGACGACGAC
GACGACGACGATGACGAATTCCCCAGCTCGGCCCCCGTCATCAAAGAAAAAGAAGAAGTGTCCGTCAAAGGAGAA
GGCTCCTCCTCCTCCTCCTCCTCCTCCTCGCCATCCTCCTCGCAGCCTGAAGCCCTCGGGACAACATCGTGCTCG
GTCAAGGCGTCGGATCCGGAGGTGATGCGCAGCTTCTATCAGCGCCTCTTCCCATGGCGTCAACTCTTCCACTGG
CTTAACCACGGTCCGACGCCGACGAGCGACTTTGCCAACCGCGAGTTTGCCTTTACGCTGCAGAACGACGCCTAT
CTGCGATACCAGTCCTACGCTACTTCAGACCTGTTGCGTCTCCCCAATTCAAGATGCAAAAGTGAAGAGTCTTTG
TTGGCTGACGGTGGGAAAGGCTTCGCAAGGACGTGTTGCGCCTCGTCCCCTCACGCTTCGAAATCGGACCCGTCT
ACTCGACCAACCCTCGCGACCGAAAGACGCTGCGCGGCTCATCAGCTTTCAAACCCATCGCCAAAGAGCTCTGCT
TCGATATCGACTTGACCGACTACGATGGCGTGCGAACTTGTTGCGACAAGGCCAATATCTGCCGCAAGTGCTGGG
CTTTTATAAACATGGCGATTCGGGTGGTTGACGTCGCTCTGCGTCAGGACTTTGGCTTCGCCCATATCCTTTGGG
TCTACTCGGGTCGCAGAGGTGCTCACGCTTGGGTGTGCGATAAGAAGGCTCGCGCCCTGGACGATCAGAAGAGGA
GGGCTATTGCTGGATACCTCGAAGTCGTCAGGGGGGGCGTCCACGGTGGCAAAAAAGTCAACGTTCGCCGTCCGC
TGCATCCTCACCTCTGGTGCGTTTCTTGCCTGTTTGCCCGATGGATGGAGCTGACGTGACTCGGGCAAACAGCCG
CAGCCTTGACCTGCTGAAAGCTCACTTCCAGCACGACGTCCTCGAAGCACAAGATCCCTGGGCAACGGCCGAGAA
AGCCGAGAAGCTTCTCCAGCTCCTCCCGGACCGCACGCTCAACGACTCGCTACGACGCAAGTGGGAGGCATCACC
AGACCGCGACTCGGCCACCAAATGGGCCGACATCGACGCCGTGGCCAAGACGGGCACTAGCAAGAGCCTCGACGC
TCGCGCCCTCCTCGAGGCCAAGCAGGACGTCGTCCTAGAATACGGCTACCCGCGGCTAGACGTCGAGGTCAGCAA
GAAGCTCAACCATCTTCTCAAGAGCCCCTTTGTCGTCCACCCGGGCACAGGCCGCGTGTGCGTTCCCATCGACAC
GTCCGCACTTGAAGACTTTGATCCTCTCGCTGTGCCGACTGTTCAGGGCTTGCTGGCTGAGGTTGATGCCTGGAA
AGAGGAAGGGGGAGGGGAAGGGGCCGGCAAGGGTGTTGCTGACTGGGAGAAGACGAGCCTTAAGCCGTATGTTGA
CTACTTTAGGTCTTTTGTGGCTGGCTTGGTGAGGGACGAGAAGGGGGTGAGGGTCAAGCGGGAGCGAGAGGAGGG
TTTGATGGATTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail