Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03183
Gene name
Locationscaffold_03:870267..871502
Strand-
Gene length (bp)1235
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01987 AIM24 Mitochondrial biogenesis AIM24 5.5E-43 51 296

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.0947 0.1492 0.0819 0.0664 0.8971 0.111 0.0437 0.0457 0.0976 0.0279

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2555
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7799
Ophiocordyceps australis map64 (Brazil) OphauB2|1840
Ophiocordyceps camponoti-floridani Ophcf2|03183 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3201
Ophiocordyceps kimflemingae Ophio5|419
Ophiocordyceps subramaniannii Hirsu2|3793

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03183
MRFSPAPLLVTVRPRTSPFPVRCLRRSIQISASPSSDAPTSGFGETADARFEVLGSAFSLLSVKLSASQRLYTRR
GTLVALTGEPANVRSKLSLLNPLPRAPLGVPFLYQRVSSTTPVTALIATRSPATSFSVVHLDGTTDWMISQRNAL
LAWTGHTLRLSSRIRTNLSMAHWGSTLVTGRGLLALSSPGQTYRLTLAEGETMAAHPANVVAYSLTSRERPQPFR
FRATDLRLEVPSAVTSWLERVEILRRLRASPAYKTLARALWRVRTTARRTVLGDRLLLQFRGPATLLLSSRGVSV
ADVLSREQVNEMADAPAGAVTVGLEERRRRGSDEAPVGDQGDDRLLHVEEGSRDGKVTFQDERELKESLR*
Coding >Ophcf2|03183
ATGCGCTTCTCCCCCGCGCCGCTATTGGTGACGGTGCGACCGCGAACATCTCCCTTTCCCGTCCGTTGTCTGCGG
CGGTCTATCCAGATCAGCGCCTCGCCAAGCTCTGACGCGCCGACGTCCGGCTTTGGAGAAACGGCCGATGCTCGG
TTCGAGGTGCTCGGCTCGGCGTTTTCGCTTCTATCAGTCAAGCTATCGGCTTCACAACGGCTATATACGCGGCGA
GGAACACTGGTTGCTTTGACTGGAGAGCCGGCAAATGTCAGATCGAAGCTATCGCTGCTGAACCCGCTGCCACGA
GCGCCGCTGGGAGTTCCCTTTCTGTACCAGCGCGTCTCGTCGACGACTCCCGTGACGGCATTGATAGCTACGCGA
TCGCCAGCGACGAGCTTCAGCGTGGTGCACCTCGACGGTACGACCGACTGGATGATATCTCAGCGCAACGCCCTG
CTCGCCTGGACAGGCCACACGCTCAGGCTATCATCACGGATCCGCACCAATCTGTCAATGGCCCACTGGGGCAGC
ACGCTGGTAACGGGCCGCGGCCTCCTAGCGCTTTCGTCGCCGGGACAGACGTACCGCCTGACACTGGCCGAGGGA
GAGACCATGGCGGCGCACCCGGCCAACGTGGTCGCTTACTCGTTAACGTCGCGGGAGAGACCCCAACCTTTCCGC
TTCAGGGCGACGGACCTGCGGCTCGAGGTGCCATCGGCCGTGACGTCGTGGCTGGAGCGCGTCGAAATCTTGCGC
CGTCTGCGTGCTTCGCCCGCTTACAAGACGCTCGCCCGGGCGCTATGGAGGGTACGGACGACGGCGCGACGGACC
GTCTTGGGGGACCGGCTGCTGTTGCAGTTTAGGGGACCGGCTACGCTGTTGCTTTCGAGTCGCGGCGTGAGCGTC
GCTGATGTGCTCTCTCGCGAGCAGGTCAATGAGATGGCTGACGCGCCGGCCGGAGCCGTCACTGTCGGTCTGGAG
GAGAGGCGGCGACGGGGATCGGACGAGGCACCGGTGGGGGATCAGGGGGATGACAGACTTCTGCACGTGGAGGAG
GGATCCCGCGATGGCAAGGTGACATTCCAAGACGAAAGGGAGCTCAAGGAGAGTCTGCGGTGA
Transcript >Ophcf2|03183
ATGCGCTTCTCCCCCGCGCCGCTATTGGTGACGGTGCGACCGCGAACATCTCCCTTTCCCGTCCGTTGTCTGCGG
CGGTCTATCCAGATCAGCGCCTCGCCAAGCTCTGACGCGCCGACGTCCGGCTTTGGAGAAACGGCCGATGCTCGG
TTCGAGGTGCTCGGCTCGGCGTTTTCGCTTCTATCAGTCAAGCTATCGGCTTCACAACGGCTATATACGCGGCGA
GGAACACTGGTTGCTTTGACTGGAGAGCCGGCAAATGTCAGATCGAAGCTATCGCTGCTGAACCCGCTGCCACGA
GCGCCGCTGGGAGTTCCCTTTCTGTACCAGCGCGTCTCGTCGACGACTCCCGTGACGGCATTGATAGCTACGCGA
TCGCCAGCGACGAGCTTCAGCGTGGTGCACCTCGACGGTACGACCGACTGGATGATATCTCAGCGCAACGCCCTG
CTCGCCTGGACAGGCCACACGCTCAGGCTATCATCACGGATCCGCACCAATCTGTCAATGGCCCACTGGGGCAGC
ACGCTGGTAACGGGCCGCGGCCTCCTAGCGCTTTCGTCGCCGGGACAGACGTACCGCCTGACACTGGCCGAGGGA
GAGACCATGGCGGCGCACCCGGCCAACGTGGTCGCTTACTCGTTAACGTCGCGGGAGAGACCCCAACCTTTCCGC
TTCAGGGCGACGGACCTGCGGCTCGAGGTGCCATCGGCCGTGACGTCGTGGCTGGAGCGCGTCGAAATCTTGCGC
CGTCTGCGTGCTTCGCCCGCTTACAAGACGCTCGCCCGGGCGCTATGGAGGGTACGGACGACGGCGCGACGGACC
GTCTTGGGGGACCGGCTGCTGTTGCAGTTTAGGGGACCGGCTACGCTGTTGCTTTCGAGTCGCGGCGTGAGCGTC
GCTGATGTGCTCTCTCGCGAGCAGGTCAATGAGATGGCTGACGCGCCGGCCGGAGCCGTCACTGTCGGTCTGGAG
GAGAGGCGGCGACGGGGATCGGACGAGGCACCGGTGGGGGATCAGGGGGATGACAGACTTCTGCACGTGGAGGAG
GGATCCCGCGATGGCAAGGTGACATTCCAAGACGAAAGGGAGCTCAAGGAGAGTCTGCGGTGA
Gene >Ophcf2|03183
ATGCGCTTCTCCCCCGCGCCGCTATTGGTGACGGTGCGACCGCGAACATCTCCCTTTCCCGTCCGTTGTCTGCGG
CGGTCTATCCAGATCAGCGCCTCGCCAAGCTCTGACGCGCCGACGTCCGGCTTTGGAGAAACGGCCGGTACGATG
CAGAGGAAAACGGGACGGGGACATGGTCGTAGCTGACTGAGTCTTGGATAGATGCTCGGTTCGAGGTGCTCGGCT
CGGCGTTTTCGCTTCTATCAGTCAAGCTATCGGCTTCACAACGGCTATATACGCGGCGAGGAACACTGGTTGCTT
TGACTGGAGAGCCGGCAAATGTAGGATGGAGGACGTTCTGGGAGGATTGGACCGACGCTGATTATGAGCTCCGAT
GACTTTAGGTCAGATCGAAGCTATCGCTGCTGAACCCGCTGCCACGAGCGCCGCTGGGAGTTCCCTTTCTGTACC
AGCGCGTCTCGTCGACGACTCCCGTGACGGCATTGATAGCTACGCGATCGCCAGCGACGAGCTTCAGCGTGGTGC
ACCTCGACGGTACGACCGACTGGATGATATCTCAGCGCAACGCCCTGCTCGCCTGGACAGGCCACACGCTCAGGC
TATCATCACGGATCCGCACCAATCTGTCAATGGCCCACTGGGGCAGCACGCTGGTAACGGGCCGCGGCCTCCTAG
CGCTTTCGTCGCCGGGACAGACGTACCGCCTGACACTGGCCGAGGGAGAGACCATGGCGGCGCACCCGGCCAACG
TGGTCGCTTACTCGTTAACGTCGCGGGAGAGACCCCAACCTTTCCGCTTCAGGGCGACGGACCTGCGGCTCGAGG
TGCCATCGGCCGTGACGTCGTGGCTGGAGCGCGTCGAAATCTTGCGCCGTCTGCGTGCTTCGCCCGCTTACAAGA
CGCTCGCCCGGGCGCTATGGAGGGTACGGACGACGGCGCGACGGACCGTCTTGGGGGACCGGCTGCTGTTGCAGT
TTAGGGGACCGGCTACGCTGTTGCTTTCGAGTCGCGGCGTGAGCGTCGCTGATGTGCTCTCTCGCGAGCAGGTCA
ATGAGATGGCTGACGCGCCGGCCGGAGCCGTCACTGTCGGTCTGGAGGAGAGGCGGCGACGGGGATCGGACGAGG
CACCGGTGGGGGATCAGGGGGATGACAGACTTCTGCACGTGGAGGAGGGATCCCGCGATGGCAAGGTGACATTCC
AAGACGAAAGGGAGCTCAAGGAGAGTCTGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail