Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03182
Gene name
Locationscaffold_03:867991..869526
Strand-
Gene length (bp)1535
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.2E-28 87 400

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 83 105 22
2 120 142 22
3 149 167 18
4 171 193 22
5 206 228 22
6 238 260 22
7 285 307 22
8 317 339 22
9 346 368 22
10 373 395 22
11 408 430 22
12 435 457 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 156.26 85.43 227.09
Alive In ants, during behavior modification 52.62 26.34 78.89
Dead In ants, recently dead 115.58 60.54 170.62

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.151275 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03182
MLQPTFRTHMTSVTATTLAANSSASLSSEKTRHDDQVVDESKPPFIALSDSDDVEASATPPPTGKTPGPEGFPDG
GFDAWLVVAGGWCALFCTFGLINCVGVFQQYYASGPLRSYGGSAVSWIMSVQIFIMIFCGTIFGRIFDNYGPKWM
LRIGTVTYVFGLMMVSLSTKYYHFFLAQSIVSAAGSSAVFNCCMSSLVTWFMRRRAAAFGIMVSGSSVGGVVLPI
MMTQLIRRIGFPWMMRVMAFIFLGLLLIACFTVKSRLPPRPRPFRALDYVESLKDIRMSVTVAGLFFFMWGMFLP
FNYALVQAQAAGTSPALIPYLLPILNAVSIIGRIVPGIIADKIGRFNVMIIISFLSAIFCLAVWTPVNNTVGIIV
FMIIFGFSSGGYIGLAPTLIAQISDISQIGTRVGTAFAIQSFGALTGSPIGGALVSARHGSYLGLQLFCGFALLI
GCFIFVAARYIQAGFKMVKV*
Coding >Ophcf2|03182
ATGCTTCAGCCTACCTTCAGGACGCACATGACGAGCGTGACGGCCACGACGCTGGCCGCAAACTCGAGTGCCTCG
CTCTCATCCGAGAAGACGCGCCATGACGATCAAGTCGTCGACGAAAGCAAGCCGCCCTTCATCGCGCTCTCCGAC
TCGGACGACGTCGAGGCTTCTGCCACGCCGCCGCCGACGGGCAAGACTCCTGGACCGGAAGGGTTTCCGGATGGG
GGGTTCGATGCCTGGCTTGTTGTTGCGGGGGGGTGGTGTGCGTTGTTTTGCACCTTCGGCCTTATCAACTGCGTG
GGAGTCTTTCAGCAGTATTATGCTTCCGGGCCGTTGAGGAGTTATGGGGGTTCGGCGGTTAGTTGGATCATGTCA
GTGCAGATCTTCATCATGATCTTTTGTGGTACCATTTTTGGGCGCATCTTCGACAACTACGGTCCTAAATGGATG
CTTCGAATCGGCACCGTCACTTACGTCTTCGGTCTGATGATGGTTTCGCTCTCAACCAAATACTACCACTTCTTC
CTCGCCCAGTCCATCGTCTCGGCCGCCGGTTCCAGCGCCGTCTTCAATTGCTGCATGTCGTCGCTCGTCACCTGG
TTTATGCGCCGTCGGGCCGCCGCCTTTGGCATCATGGTTTCGGGCTCGTCGGTTGGTGGTGTTGTGTTACCCATC
ATGATGACGCAGCTTATTCGCCGTATCGGTTTCCCCTGGATGATGCGAGTTATGGCTTTTATCTTTCTGGGCTTG
TTGCTCATCGCTTGCTTCACCGTCAAGTCTCGTCTACCGCCGCGGCCGAGGCCCTTTCGCGCTTTGGACTATGTT
GAGAGTCTCAAGGATATCCGCATGTCCGTCACCGTGGCTGGCTTGTTCTTCTTCATGTGGGGGATGTTCTTGCCC
TTCAACTATGCCCTGGTTCAGGCTCAGGCTGCGGGCACCTCGCCGGCTTTGATTCCTTACTTGCTGCCCATTCTC
AACGCCGTGAGCATCATCGGCCGCATCGTGCCCGGCATCATCGCCGACAAAATCGGCCGGTTCAACGTCATGATC
ATCATCAGCTTCCTGTCCGCCATCTTCTGCCTCGCCGTGTGGACGCCCGTCAACAACACGGTCGGCATCATCGTC
TTCATGATCATCTTTGGCTTCTCGTCCGGCGGCTACATTGGTCTGGCCCCGACTCTCATCGCCCAAATATCCGAC
ATCAGCCAGATCGGCACCAGAGTTGGCACCGCCTTTGCCATCCAGTCGTTTGGCGCCTTGACCGGCAGCCCCATT
GGCGGTGCTCTCGTTTCCGCTCGTCATGGCTCATACCTCGGCCTGCAGCTTTTTTGCGGCTTTGCCTTGTTGATT
GGCTGCTTCATCTTTGTTGCTGCCAGGTATATCCAAGCTGGCTTCAAGATGGTCAAGGTGTGA
Transcript >Ophcf2|03182
ATGCTTCAGCCTACCTTCAGGACGCACATGACGAGCGTGACGGCCACGACGCTGGCCGCAAACTCGAGTGCCTCG
CTCTCATCCGAGAAGACGCGCCATGACGATCAAGTCGTCGACGAAAGCAAGCCGCCCTTCATCGCGCTCTCCGAC
TCGGACGACGTCGAGGCTTCTGCCACGCCGCCGCCGACGGGCAAGACTCCTGGACCGGAAGGGTTTCCGGATGGG
GGGTTCGATGCCTGGCTTGTTGTTGCGGGGGGGTGGTGTGCGTTGTTTTGCACCTTCGGCCTTATCAACTGCGTG
GGAGTCTTTCAGCAGTATTATGCTTCCGGGCCGTTGAGGAGTTATGGGGGTTCGGCGGTTAGTTGGATCATGTCA
GTGCAGATCTTCATCATGATCTTTTGTGGTACCATTTTTGGGCGCATCTTCGACAACTACGGTCCTAAATGGATG
CTTCGAATCGGCACCGTCACTTACGTCTTCGGTCTGATGATGGTTTCGCTCTCAACCAAATACTACCACTTCTTC
CTCGCCCAGTCCATCGTCTCGGCCGCCGGTTCCAGCGCCGTCTTCAATTGCTGCATGTCGTCGCTCGTCACCTGG
TTTATGCGCCGTCGGGCCGCCGCCTTTGGCATCATGGTTTCGGGCTCGTCGGTTGGTGGTGTTGTGTTACCCATC
ATGATGACGCAGCTTATTCGCCGTATCGGTTTCCCCTGGATGATGCGAGTTATGGCTTTTATCTTTCTGGGCTTG
TTGCTCATCGCTTGCTTCACCGTCAAGTCTCGTCTACCGCCGCGGCCGAGGCCCTTTCGCGCTTTGGACTATGTT
GAGAGTCTCAAGGATATCCGCATGTCCGTCACCGTGGCTGGCTTGTTCTTCTTCATGTGGGGGATGTTCTTGCCC
TTCAACTATGCCCTGGTTCAGGCTCAGGCTGCGGGCACCTCGCCGGCTTTGATTCCTTACTTGCTGCCCATTCTC
AACGCCGTGAGCATCATCGGCCGCATCGTGCCCGGCATCATCGCCGACAAAATCGGCCGGTTCAACGTCATGATC
ATCATCAGCTTCCTGTCCGCCATCTTCTGCCTCGCCGTGTGGACGCCCGTCAACAACACGGTCGGCATCATCGTC
TTCATGATCATCTTTGGCTTCTCGTCCGGCGGCTACATTGGTCTGGCCCCGACTCTCATCGCCCAAATATCCGAC
ATCAGCCAGATCGGCACCAGAGTTGGCACCGCCTTTGCCATCCAGTCGTTTGGCGCCTTGACCGGCAGCCCCATT
GGCGGTGCTCTCGTTTCCGCTCGTCATGGCTCATACCTCGGCCTGCAGCTTTTTTGCGGCTTTGCCTTGTTGATT
GGCTGCTTCATCTTTGTTGCTGCCAGGTATATCCAAGCTGGCTTCAAGATGGTCAAGGTGTGA
Gene >Ophcf2|03182
ATGCTTCAGCCTACCTTCAGGACGCACATGACGAGCGTGACGGCCACGACGCTGGCCGCAAACTCGAGTGCCTCG
CTCTCATCCGAGAAGACGCGCCATGACGATCAAGTCGTCGACGAAAGCAAGCCGCCCTTCATCGCGCTCTCCGAC
TCGGACGACGTCGAGGCTTCTGCCACGCCGCCGCCGACGGGCAAGACTCCTGGACCGGAAGGGTTTCCGGATGGG
GGGTTCGATGCCTGGCTTGTTGTTGCGGGGGGGTGGTGTGCGTTGTTTTGCACCTTCGGCCTTATCAACTGCGTG
GGAGTCTTTCAGCAGTATTATGCTTCCGGGCCGTTGAGGAGTTATGGGGGTTCGGCGGTTAGTTGGATCATGTCA
GTGCAGATCTTCATCATGATCTTTTGTGGTACCATTGTGAGTCTGTTCTGGCCGGTTTGAATCTTTTAACTGGGT
TTGGCTAACGGAGCGAATCAGTTTGGGCGCATCTTCGACAACTACGGTCCTAAATGGATGCTTCGAATCGGCACC
GTCACTTACGTCTTCGGTCTGATGATGGTTTCGCTCTCAACCAAATACTACCACTTCTTCCTCGCCCAGTCCATC
GTCTCGGCCGCCGGTTCCAGCGCCGTCTTCAATTGCTGCATGTCGTCGCTCGTCACCTGGTTTATGCGCCGTCGG
GCCGCCGCCTTTGGCATCATGGTTTCGGGCTCGTCGGTTGGTGGTGTTGTGTTACCCATCATGATGACGCAGCTT
ATTCGCCGTATCGGTTTCCCCTGGATGATGCGAGTTATGGCTTTTATCTTTCTGGGCTTGTTGCTCATCGCTTGC
TTCACCGTCAAGTCTCGTCTACCGCCGCGGCCGAGGCCCTTTCGCGCTTTGGACTATGTTGAGAGTCTCAAGGAT
ATCCGCATGTCCGTCACCGTGGCTGGCTTGTTCTTCTTCATGTGGGGGATGTTCTTGCCCTTCAACTATGCCCTG
GTTCAGGCTCAGGCTGCGGGCACCTCGCCGGCTTTGATTCCTTACTTGCTGCCCATTCTCAACGCCGTGAGGTGA
GTCTTGTTCCTCCCCATGTTCCCATAGTGTCAAAGTCTGACGAGAAGCAACCTCACAGCATCATCGGCCGCATCG
TGCCCGGCATCATCGCCGACAAAATCGGCCGGTTCAACGTCATGATCATCATCAGCTTCCTGTCCGCCATCTTCT
GCCTCGCCGTGTGGACGCCCGTCAACAACACGGTCGGCATCATCGTCTTCATGATCATCTTTGGCTTCTCGTCCG
GCGGCTACATTGGTCTGGCCCCGACTCTCATCGCCCAAATATCCGACATCAGCCAGATCGGCACCAGAGTTGGCA
CCGCCTTTGCCATCCAGTCGTTTGGCGCCTTGACCGGCAGCCCCATTGGCGGTGCTCTCGTTTCCGCTCGTCATG
GCTCATACCTCGGCCTGCAGCTTTTTTGCGGCTTTGCCTTGTTGATTGGCTGCTTCATCTTTGTTGCTGCCAGGT
ATATCCAAGCTGGCTTCAAGATGGTCAAGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail