Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03181
Gene name
Locationscaffold_03:867112..867681
Strand-
Gene length (bp)569
Transcript length (bp)447
Coding sequence length (bp)447
Protein length (aa) 149

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.1E-11 23 111
PF13857 Ank_5 Ankyrin repeats (many copies) 4.9E-11 44 89
PF00023 Ank Ankyrin repeat 5.6E-08 51 82
PF13606 Ank_3 Ankyrin repeat 2.0E-06 51 78
PF13637 Ank_4 Ankyrin repeats (many copies) 6.6E-05 25 71

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7189 0.4314 0.079 0.318 0.5372 0.1237 0.1158 0.1334 0.2202 0.1231

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2556
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6710
Ophiocordyceps australis map64 (Brazil) OphauB2|3716
Ophiocordyceps camponoti-floridani Ophcf2|03181 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3199
Ophiocordyceps kimflemingae Ophio5|421
Ophiocordyceps subramaniannii Hirsu2|3796

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03181
MDAPEAAASWPPPEVIALASRMYEAARQGDLAVLQQALPAGLPANLTNDKGETLLMLAAYHGHAAVVQLLLDHGA
DPNRLNDRGQSPLAGAVFKAEDAVIETLLRGGADPDHGAPTALQCVDMFKQGDKWASKMENAPGRGKAQSSRH*
Coding >Ophcf2|03181
ATGGACGCCCCCGAAGCAGCAGCCTCGTGGCCGCCACCCGAAGTAATTGCCCTGGCTTCCCGCATGTACGAAGCC
GCCCGTCAAGGCGACCTGGCCGTCTTGCAGCAAGCCCTGCCAGCCGGCCTGCCAGCCAACCTGACCAACGACAAG
GGCGAGACGCTGCTCATGTTGGCTGCGTATCATGGCCATGCGGCTGTTGTGCAACTGCTGCTCGATCACGGCGCT
GATCCGAACCGGCTAAACGATCGGGGGCAGAGTCCTCTTGCTGGCGCCGTCTTCAAGGCTGAGGATGCTGTTATT
GAGACGCTCCTCCGGGGCGGGGCCGATCCGGATCACGGGGCTCCGACTGCCCTGCAATGCGTTGACATGTTCAAG
CAGGGGGACAAGTGGGCGAGCAAGATGGAGAATGCTCCTGGACGCGGCAAGGCGCAGTCAAGCCGGCACTGA
Transcript >Ophcf2|03181
ATGGACGCCCCCGAAGCAGCAGCCTCGTGGCCGCCACCCGAAGTAATTGCCCTGGCTTCCCGCATGTACGAAGCC
GCCCGTCAAGGCGACCTGGCCGTCTTGCAGCAAGCCCTGCCAGCCGGCCTGCCAGCCAACCTGACCAACGACAAG
GGCGAGACGCTGCTCATGTTGGCTGCGTATCATGGCCATGCGGCTGTTGTGCAACTGCTGCTCGATCACGGCGCT
GATCCGAACCGGCTAAACGATCGGGGGCAGAGTCCTCTTGCTGGCGCCGTCTTCAAGGCTGAGGATGCTGTTATT
GAGACGCTCCTCCGGGGCGGGGCCGATCCGGATCACGGGGCTCCGACTGCCCTGCAATGCGTTGACATGTTCAAG
CAGGGGGACAAGTGGGCGAGCAAGATGGAGAATGCTCCTGGACGCGGCAAGGCGCAGTCAAGCCGGCACTGA
Gene >Ophcf2|03181
ATGGACGCCCCCGAAGCAGCAGCCTCGTGGCCGCCACCCGAAGTAATTGCCCTGGCTTCCCGCATGTACGAAGCC
GCCCGTCAAGGCGACCTGGCCGTCTTGCAGCAAGCCCTGCCAGCCGGCCTGCCAGCCAACCTGACCAACGACAAG
GGCGAGACGCTGGTGGGTGATGGCCGATCGGACAGAGCAACGATGATGGGCGATAGGCTGAGACACTGCTGGAGC
TCATGTTGGCTGCGTATCATGGCCATGCGGCTGTTGTGCAACTGCTGCTCGATCACGGCGCTGATCCGAACCGGC
TAAACGATCGGGGGCAGAGTCCTCTTGCTGGCGCCGTCTTCAAGGCTGAGGATGCTGTTATTGAGGTGTGCTGGC
TGCTCTCCCGTATCACTTGTTCGGTGTTTCTTACTTCTCCGTGCCGGTAGACGCTCCTCCGGGGCGGGGCCGATC
CGGATCACGGGGCTCCGACTGCCCTGCAATGCGTTGACATGTTCAAGCAGGGGGACAAGTGGGCGAGCAAGATGG
AGAATGCTCCTGGACGCGGCAAGGCGCAGTCAAGCCGGCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail