Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03180
Gene name
Locationscaffold_03:866130..867073
Strand+
Gene length (bp)943
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20434 BD-FAE BD-FAE 1.1E-08 43 148

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1365 0.1344 0.774 0.1059 0.193 0.108 0.4355 0.3286 0.0847 0.0182

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999445

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup165
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3357
Ophiocordyceps australis 1348a (Ghana) OphauG2|932
Ophiocordyceps australis map64 (Brazil) OphauB2|5831
Ophiocordyceps camponoti-floridani Ophcf2|03180 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04852
Ophiocordyceps camponoti-rufipedis Ophun1|6378
Ophiocordyceps camponoti-rufipedis Ophun1|6514
Ophiocordyceps kimflemingae Ophio5|422
Ophiocordyceps kimflemingae Ophio5|5508
Ophiocordyceps subramaniannii Hirsu2|1424
Ophiocordyceps subramaniannii Hirsu2|3825
Ophiocordyceps subramaniannii Hirsu2|7270
Ophiocordyceps subramaniannii Hirsu2|8261

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03180
MMNFKLLLFFLASSASLAGAVFQQLSYGQHPRQVVGVWDDGQSNPASPWIVYIHGGAWRNMQQSYRDFEPSVNNM
MTSGLLPRGTVYASIDYRLSPCAIPNANPCPYPVQHPDHILDVRTALQMLAQRRGLKSNYILIGHSAGATLSFQL
LMGEAALQGHPLIRAPLPTTVIGIAGIYDMRGLNNRFGGQYGDFLTEAFGPDQRDWDRASPALFAGSFRERLPSP
GGVILARSAEDSLVDGPELDEMARRLSRDGIALAVERRLRGEHNAVWQDGHQIPSLVTRVMPRRRQK*
Coding >Ophcf2|03180
ATGATGAATTTCAAATTGCTGCTCTTCTTCTTGGCTTCGTCAGCCTCACTTGCCGGAGCCGTCTTCCAGCAACTC
TCGTATGGCCAGCATCCTCGACAGGTTGTAGGCGTGTGGGATGACGGCCAATCCAACCCTGCCTCACCGTGGATC
GTATATATCCACGGCGGCGCCTGGCGAAACATGCAGCAATCATACCGAGACTTTGAACCATCCGTCAACAACATG
ATGACTTCAGGCCTCCTCCCCAGAGGCACCGTCTACGCCTCCATCGACTACCGCCTCTCCCCATGTGCCATACCA
AACGCCAACCCCTGCCCCTATCCAGTCCAACACCCAGATCACATCTTGGACGTCCGCACGGCACTACAAATGCTC
GCCCAACGCCGCGGCCTGAAGAGCAACTACATCCTCATCGGACACTCAGCCGGAGCAACACTATCCTTCCAGCTG
CTCATGGGCGAAGCCGCGCTCCAAGGCCACCCGCTAATCAGGGCACCGCTCCCAACAACCGTCATCGGCATCGCC
GGAATCTACGACATGAGGGGCCTCAACAATCGCTTCGGCGGCCAGTACGGCGATTTTCTCACCGAAGCTTTTGGT
CCGGATCAGCGCGATTGGGATAGAGCGTCGCCGGCTCTTTTTGCTGGTTCGTTTCGCGAGCGCTTGCCTTCTCCT
GGGGGGGTGATTCTGGCACGCTCGGCCGAGGACAGCCTCGTCGACGGCCCTGAGCTGGATGAGATGGCCCGAAGG
CTTTCTAGGGATGGGATTGCCCTGGCTGTTGAGAGGAGACTCAGGGGCGAGCACAATGCCGTGTGGCAGGACGGC
CATCAGATTCCCAGTCTCGTGACTCGAGTGATGCCTCGACGACGACAGAAGTAA
Transcript >Ophcf2|03180
ATGATGAATTTCAAATTGCTGCTCTTCTTCTTGGCTTCGTCAGCCTCACTTGCCGGAGCCGTCTTCCAGCAACTC
TCGTATGGCCAGCATCCTCGACAGGTTGTAGGCGTGTGGGATGACGGCCAATCCAACCCTGCCTCACCGTGGATC
GTATATATCCACGGCGGCGCCTGGCGAAACATGCAGCAATCATACCGAGACTTTGAACCATCCGTCAACAACATG
ATGACTTCAGGCCTCCTCCCCAGAGGCACCGTCTACGCCTCCATCGACTACCGCCTCTCCCCATGTGCCATACCA
AACGCCAACCCCTGCCCCTATCCAGTCCAACACCCAGATCACATCTTGGACGTCCGCACGGCACTACAAATGCTC
GCCCAACGCCGCGGCCTGAAGAGCAACTACATCCTCATCGGACACTCAGCCGGAGCAACACTATCCTTCCAGCTG
CTCATGGGCGAAGCCGCGCTCCAAGGCCACCCGCTAATCAGGGCACCGCTCCCAACAACCGTCATCGGCATCGCC
GGAATCTACGACATGAGGGGCCTCAACAATCGCTTCGGCGGCCAGTACGGCGATTTTCTCACCGAAGCTTTTGGT
CCGGATCAGCGCGATTGGGATAGAGCGTCGCCGGCTCTTTTTGCTGGTTCGTTTCGCGAGCGCTTGCCTTCTCCT
GGGGGGGTGATTCTGGCACGCTCGGCCGAGGACAGCCTCGTCGACGGCCCTGAGCTGGATGAGATGGCCCGAAGG
CTTTCTAGGGATGGGATTGCCCTGGCTGTTGAGAGGAGACTCAGGGGCGAGCACAATGCCGTGTGGCAGGACGGC
CATCAGATTCCCAGTCTCGTGACTCGAGTGATGCCTCGACGACGACAGAAGTAA
Gene >Ophcf2|03180
ATGATGAATTTCAAATTGCTGCTCTTCTTCTTGGCTTCGTCAGCCTCACTTGCCGGAGCCGTCTTCCAGCAACTC
TCGTATGGCCAGCATCCTCGACAGGTTGTAGGCGTGTGGGATGACGGCCAATCCAACCCTGCCTCACCGTGGATC
GTGTAAGTTCTACCCCCCCCCCCCCCCCCTTTGACGAAACACTCGCCTCTCACTAACAAACAACAGATATATCCA
CGGCGGCGCCTGGCGAAACATGCAGCAATCATACCGAGACTTTGAACCATCCGTCAACAACATGATGACTTCAGG
CCTCCTCCCCAGAGGCACCGTCTACGCCTCCATCGACTACCGCCTCTCCCCATGTGCCATACCAAACGCCAACCC
CTGCCCCTATCCAGTCCAACACCCAGATCACATCTTGGACGTCCGCACGGCACTACAAATGCTCGCCCAACGCCG
CGGCCTGAAGAGCAACTACATCCTCATCGGACACTCAGCCGGAGCAACACTATCCTTCCAGCTGCTCATGGGCGA
AGCCGCGCTCCAAGGCCACCCGCTAATCAGGGCACCGCTCCCAACAACCGTCATCGGCATCGCCGGAATCTACGA
CATGAGGGGCCTCAACAATCGCTTCGGCGGCCAGTACGGCGATTTTCTCACCGAAGCTTTTGGTCCGGATCAGCG
CGATTGGGATAGAGCGTCGCCGGCTCTTTTTGCTGGTTCGTTTCGCGAGCGCTTGCCTTCTCCTGGGGGGGTGAT
TCTGGCACGCTCGGCCGAGGACAGCCTCGTCGACGGCCCTGAGCTGGATGAGATGGCCCGAAGGCTTTCTAGGGA
TGGGATTGCCCTGGCTGTTGAGAGGAGACTCAGGGGCGAGCACAATGCCGTGTGGCAGGACGGCCATCAGATTCC
CAGTCTCGTGACTCGAGTGATGCCTCGACGACGACAGAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail