Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03171
Gene name
Locationscaffold_03:837263..838186
Strand+
Gene length (bp)923
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family 4.4E-38 63 209

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7757 0.7578 0.0556 0.1201 0.0481 0.0088 0.0869 0.1021 0.0766 0.0015

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1381
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6422
Ophiocordyceps australis map64 (Brazil) OphauB2|4278
Ophiocordyceps camponoti-floridani Ophcf2|03171 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5762
Ophiocordyceps kimflemingae Ophio5|435
Ophiocordyceps subramaniannii Hirsu2|10821

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03171
MNGDDPPERPDYITSIINGLERYNPEAVGTLETYLQEQCEEKFCDCNANRTLLKLYQLNPDRMKDEVITNILVKA
LTQFPSAQFSLALHIINPSVAATGELPEALAKLRSLNSQLEGAQYTNFWATVDGDDICADLVADISGFEDLIRHR
IAQLISQAFREVNMDLLEPWLGLGKDATKKFVTEVCGWEVDDQGNAKIPPNPENEAKKAEIREDVNVDQFARVIR
RAWETTV*
Coding >Ophcf2|03171
ATGAACGGCGACGACCCGCCCGAGCGGCCGGATTACATCACCAGCATCATCAATGGCCTCGAGCGCTACAACCCC
GAAGCCGTCGGCACCCTCGAGACGTATCTACAGGAGCAGTGCGAGGAAAAGTTTTGCGACTGCAACGCCAACAGG
ACCTTGCTGAAGCTATACCAGCTCAACCCCGATCGCATGAAGGATGAGGTCATCACCAATATCCTCGTCAAAGCC
TTGACGCAGTTCCCCTCTGCCCAATTCTCCCTCGCCCTTCACATCATCAATCCATCAGTCGCTGCGACCGGAGAG
CTCCCCGAGGCCCTGGCAAAGCTGCGCTCGCTCAACTCGCAGCTCGAAGGCGCCCAGTACACCAACTTCTGGGCG
ACTGTCGACGGCGATGACATCTGTGCCGACCTCGTGGCCGACATCTCTGGCTTCGAGGACCTCATCCGGCACCGC
ATCGCTCAACTCATCTCGCAGGCTTTCAGAGAGGTCAACATGGATCTTCTCGAGCCGTGGCTCGGCCTCGGCAAG
GACGCTACCAAGAAGTTCGTGACGGAAGTCTGCGGCTGGGAAGTCGACGACCAAGGAAACGCCAAGATCCCCCCC
AACCCGGAGAACGAGGCGAAAAAGGCCGAGATCCGCGAGGACGTCAACGTCGACCAGTTCGCCAGAGTCATCCGA
CGAGCCTGGGAGACGACTGTGTGA
Transcript >Ophcf2|03171
ATGAACGGCGACGACCCGCCCGAGCGGCCGGATTACATCACCAGCATCATCAATGGCCTCGAGCGCTACAACCCC
GAAGCCGTCGGCACCCTCGAGACGTATCTACAGGAGCAGTGCGAGGAAAAGTTTTGCGACTGCAACGCCAACAGG
ACCTTGCTGAAGCTATACCAGCTCAACCCCGATCGCATGAAGGATGAGGTCATCACCAATATCCTCGTCAAAGCC
TTGACGCAGTTCCCCTCTGCCCAATTCTCCCTCGCCCTTCACATCATCAATCCATCAGTCGCTGCGACCGGAGAG
CTCCCCGAGGCCCTGGCAAAGCTGCGCTCGCTCAACTCGCAGCTCGAAGGCGCCCAGTACACCAACTTCTGGGCG
ACTGTCGACGGCGATGACATCTGTGCCGACCTCGTGGCCGACATCTCTGGCTTCGAGGACCTCATCCGGCACCGC
ATCGCTCAACTCATCTCGCAGGCTTTCAGAGAGGTCAACATGGATCTTCTCGAGCCGTGGCTCGGCCTCGGCAAG
GACGCTACCAAGAAGTTCGTGACGGAAGTCTGCGGCTGGGAAGTCGACGACCAAGGAAACGCCAAGATCCCCCCC
AACCCGGAGAACGAGGCGAAAAAGGCCGAGATCCGCGAGGACGTCAACGTCGACCAGTTCGCCAGAGTCATCCGA
CGAGCCTGGGAGACGACTGTGTGA
Gene >Ophcf2|03171
ATGAACGGCGACGACCCGCCCGAGCGGCCGGATTACATCACCAGCATCATCAATGGCCTCGAGCGCTACAACCCC
GAAGCCGTCGGCACCCTCGAGACGTATCTACAGGAGCAGTGCGAGGAAAAGTTTTGCGACTGCAACGCCAACAGG
ACCTTGCTGAAGCTGTGAGTGGCGCTGCTTGAATCTGTGACTTTTCGAAATCTGCCTAGGCTTCCCGGGTGCCAG
GGAAGCAGCCCCTGTATGATGTTGCGTAAACGTTTCCTATTACCTGACCGCGACGGGCTCTTTGCAGTCCTGTCG
CTGATGAAGTCTTGATCTGACCTTGGCTGTCATTCCTCTTCTCTGACGCATCCATCTCCGAGCCGCGTGCGTAAC
TAATCTTCAATAGATACCAGCTCAACCCCGATCGCATGAAGGATGAGGTCATCACCAATATCCTCGTCAAAGCCT
TGACGCAGTTCCCCTCTGCCCAATTCTCCCTCGCCCTTCACATCATCAATCCATCAGTCGCTGCGACCGGAGAGC
TCCCCGAGGCCCTGGCAAAGCTGCGCTCGCTCAACTCGCAGCTCGAAGGCGCCCAGTACACCAACTTCTGGGCGA
CTGTCGACGGCGATGACATCTGTGCCGACCTCGTGGCCGACATCTCTGGCTTCGAGGACCTCATCCGGCACCGCA
TCGCTCAACTCATCTCGCAGGCTTTCAGAGAGGTCAACATGGATCTTCTCGAGCCGTGGCTCGGCCTCGGCAAGG
ACGCTACCAAGAAGTTCGTGACGGAAGTCTGCGGCTGGGAAGTCGACGACCAAGGAAACGCCAAGATCCCCCCCA
ACCCGGAGAACGAGGCGAAAAAGGCCGAGATCCGCGAGGACGTCAACGTCGACCAGTTCGCCAGAGTCATCCGAC
GAGCCTGGGAGACGACTGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail