Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03162
Gene name
Locationscaffold_03:811813..814443
Strand-
Gene length (bp)2630
Transcript length (bp)2061
Coding sequence length (bp)2061
Protein length (aa) 687

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 6.4E-68 132 563

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 77 99 22
2 157 179 22
3 216 238 22
4 248 270 22
5 358 380 22
6 400 417 17
7 430 452 22
8 462 484 22
9 497 516 19
10 526 548 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 3.13 0.86 5.39
Alive In ants, during behavior modification 1.25 0.19 2.32
Dead In ants, recently dead 0.87 0.09 1.65

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.007753 yes
Alive Dead 0.302384 no
Dead Fungus 0.001043 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03162
MTDADLVTDVKIFAHDHLPNVPYDRVLRAARVAKDIRLYDEIARRTRIDGSHLPVRLTDKEKDALCREKDVTFSE
KGMRIVIATVSLAALLQGFVQSSFNGASLYAGAWDLDLHHKGQGVTLDVWRLGAANASPWMVAALLGCPLSLPIN
YWFGRRGAIAVAAFLILASSIGAIFVSNWKQMFCVRIVNGLGMGIKAVSTPILASETAIGFWRGSAILAWQLWVA
FGIMAGFAFNMIFSIAKDDRVILRLIQGAPLVPSLALLVLALGFCPESPRYHLMKGPNYSVQKAHEALKKVRNTE
LQALRDLYMVYKALEQERVGLLSWDPHVSLSPGFFWVMRDFLSQYGQLFRRRRLYNALLSACTVNLAQQLCGVNV
FVFYSGSLFTRDAGSEPDPVSKLKAMAYSLGFGAINFLFALPAVKSIDTLGRRKWLLATLPFMSLFMLGAGLSYF
LGDEESEVRKGVTAGFLYLFAIAYSPGLGPIPFTLASEGFPLTHREAGTSCAISTNLFFAGLLSICYPRIDVALG
QAGSLGLFSGLNIVALVLVFLLVEETKQLTLEELDHVFAVSKRDFMRFQLAEYLPWLLRQYLCGGQDKPPVLYKN
MVSGPGPTPNNARTAYNMPSYVESQSMRAQRSRTGETDRMEAGSRGNIVEMDKPVRYNQYYSRVPVPHGTGGNGS
YRPDSPGWNYR*
Coding >Ophcf2|03162
ATGACGGACGCAGACCTGGTGACGGACGTCAAAATCTTTGCACACGATCATCTCCCCAACGTCCCTTATGATCGT
GTTCTTCGTGCTGCTCGAGTTGCCAAGGACATTCGTCTATACGATGAGATTGCGCGGAGGACGCGTATCGACGGC
AGTCACCTGCCCGTGCGTCTGACGGATAAAGAGAAGGACGCCCTGTGCAGAGAAAAGGACGTGACGTTTAGCGAA
AAGGGGATGCGCATTGTCATTGCGACTGTGTCGTTGGCGGCTCTCTTACAAGGGTTTGTTCAGTCATCGTTCAAT
GGGGCTTCATTGTATGCCGGTGCCTGGGACCTGGACCTTCATCACAAAGGCCAGGGCGTTACTCTCGACGTCTGG
CGTCTCGGAGCGGCCAATGCATCGCCCTGGATGGTCGCCGCCCTGTTGGGATGTCCGCTCTCGCTGCCCATCAAC
TACTGGTTCGGCAGACGAGGAGCCATCGCCGTGGCAGCCTTTCTGATCCTCGCGAGCTCCATCGGCGCCATCTTC
GTCTCCAACTGGAAGCAGATGTTTTGCGTCCGGATCGTCAATGGCTTGGGCATGGGCATCAAGGCCGTGAGCACT
CCTATCCTGGCTTCCGAGACGGCAATCGGCTTCTGGCGCGGCTCGGCTATACTCGCCTGGCAACTTTGGGTTGCC
TTTGGTATTATGGCAGGCTTCGCCTTCAACATGATCTTCAGCATAGCCAAAGACGACAGGGTGATTCTCCGTCTG
ATACAGGGCGCTCCTCTCGTCCCCAGTCTCGCCCTTCTCGTCCTGGCCTTGGGCTTCTGCCCCGAGTCGCCGCGC
TATCACCTCATGAAGGGGCCCAACTATAGCGTTCAAAAGGCACACGAGGCTCTCAAGAAGGTCAGGAACACCGAG
CTCCAAGCCTTACGCGACCTGTACATGGTCTACAAGGCGCTCGAGCAAGAACGAGTCGGGCTTCTCAGCTGGGAT
CCGCACGTGTCCTTGTCGCCAGGCTTCTTTTGGGTCATGCGCGATTTCCTCTCCCAGTACGGGCAACTCTTTCGA
CGGCGGCGGCTGTACAACGCCCTTTTATCCGCTTGCACAGTCAACCTAGCGCAGCAGCTTTGCGGAGTTAACGTT
TTCGTCTTCTACTCTGGTTCTCTTTTTACTCGAGATGCTGGCTCCGAACCGGACCCCGTGTCTAAACTCAAAGCT
ATGGCCTATAGTCTAGGTTTCGGGGCCATCAACTTCCTCTTTGCTTTGCCGGCAGTGAAGAGCATTGACACACTC
GGTCGACGGAAATGGCTTCTGGCCACGCTGCCTTTCATGTCTCTGTTCATGCTTGGCGCCGGTCTCTCCTATTTT
CTTGGAGACGAAGAGAGTGAGGTCCGGAAAGGGGTGACGGCTGGTTTCTTATATCTGTTTGCTATCGCCTACTCA
CCTGGCTTGGGCCCGATTCCGTTCACGCTGGCATCGGAAGGCTTTCCGCTGACCCATCGAGAGGCAGGAACATCT
TGTGCCATTTCGACCAACTTGTTCTTCGCTGGACTGTTATCCATCTGCTACCCAAGAATCGACGTGGCACTCGGT
CAGGCCGGATCACTCGGCCTGTTCAGCGGGCTGAATATTGTGGCCCTTGTACTCGTGTTCCTCTTAGTAGAAGAG
ACGAAGCAGCTGACGCTTGAAGAGCTCGACCACGTCTTTGCCGTGTCGAAGCGTGACTTCATGCGCTTCCAGCTA
GCCGAGTATCTGCCTTGGCTACTAAGGCAGTATCTCTGCGGGGGCCAAGACAAGCCGCCTGTGCTTTACAAGAAC
ATGGTATCAGGACCTGGCCCAACGCCAAATAACGCGAGAACGGCGTACAACATGCCGTCGTATGTCGAGAGCCAG
TCGATGCGTGCTCAACGGTCCCGCACAGGGGAGACGGACAGAATGGAGGCGGGAAGCCGCGGGAATATCGTGGAG
ATGGACAAACCTGTGCGATACAATCAGTACTATTCGCGGGTTCCGGTTCCGCATGGCACGGGTGGCAATGGGAGT
TATCGGCCGGATTCTCCGGGTTGGAATTATCGTTGA
Transcript >Ophcf2|03162
ATGACGGACGCAGACCTGGTGACGGACGTCAAAATCTTTGCACACGATCATCTCCCCAACGTCCCTTATGATCGT
GTTCTTCGTGCTGCTCGAGTTGCCAAGGACATTCGTCTATACGATGAGATTGCGCGGAGGACGCGTATCGACGGC
AGTCACCTGCCCGTGCGTCTGACGGATAAAGAGAAGGACGCCCTGTGCAGAGAAAAGGACGTGACGTTTAGCGAA
AAGGGGATGCGCATTGTCATTGCGACTGTGTCGTTGGCGGCTCTCTTACAAGGGTTTGTTCAGTCATCGTTCAAT
GGGGCTTCATTGTATGCCGGTGCCTGGGACCTGGACCTTCATCACAAAGGCCAGGGCGTTACTCTCGACGTCTGG
CGTCTCGGAGCGGCCAATGCATCGCCCTGGATGGTCGCCGCCCTGTTGGGATGTCCGCTCTCGCTGCCCATCAAC
TACTGGTTCGGCAGACGAGGAGCCATCGCCGTGGCAGCCTTTCTGATCCTCGCGAGCTCCATCGGCGCCATCTTC
GTCTCCAACTGGAAGCAGATGTTTTGCGTCCGGATCGTCAATGGCTTGGGCATGGGCATCAAGGCCGTGAGCACT
CCTATCCTGGCTTCCGAGACGGCAATCGGCTTCTGGCGCGGCTCGGCTATACTCGCCTGGCAACTTTGGGTTGCC
TTTGGTATTATGGCAGGCTTCGCCTTCAACATGATCTTCAGCATAGCCAAAGACGACAGGGTGATTCTCCGTCTG
ATACAGGGCGCTCCTCTCGTCCCCAGTCTCGCCCTTCTCGTCCTGGCCTTGGGCTTCTGCCCCGAGTCGCCGCGC
TATCACCTCATGAAGGGGCCCAACTATAGCGTTCAAAAGGCACACGAGGCTCTCAAGAAGGTCAGGAACACCGAG
CTCCAAGCCTTACGCGACCTGTACATGGTCTACAAGGCGCTCGAGCAAGAACGAGTCGGGCTTCTCAGCTGGGAT
CCGCACGTGTCCTTGTCGCCAGGCTTCTTTTGGGTCATGCGCGATTTCCTCTCCCAGTACGGGCAACTCTTTCGA
CGGCGGCGGCTGTACAACGCCCTTTTATCCGCTTGCACAGTCAACCTAGCGCAGCAGCTTTGCGGAGTTAACGTT
TTCGTCTTCTACTCTGGTTCTCTTTTTACTCGAGATGCTGGCTCCGAACCGGACCCCGTGTCTAAACTCAAAGCT
ATGGCCTATAGTCTAGGTTTCGGGGCCATCAACTTCCTCTTTGCTTTGCCGGCAGTGAAGAGCATTGACACACTC
GGTCGACGGAAATGGCTTCTGGCCACGCTGCCTTTCATGTCTCTGTTCATGCTTGGCGCCGGTCTCTCCTATTTT
CTTGGAGACGAAGAGAGTGAGGTCCGGAAAGGGGTGACGGCTGGTTTCTTATATCTGTTTGCTATCGCCTACTCA
CCTGGCTTGGGCCCGATTCCGTTCACGCTGGCATCGGAAGGCTTTCCGCTGACCCATCGAGAGGCAGGAACATCT
TGTGCCATTTCGACCAACTTGTTCTTCGCTGGACTGTTATCCATCTGCTACCCAAGAATCGACGTGGCACTCGGT
CAGGCCGGATCACTCGGCCTGTTCAGCGGGCTGAATATTGTGGCCCTTGTACTCGTGTTCCTCTTAGTAGAAGAG
ACGAAGCAGCTGACGCTTGAAGAGCTCGACCACGTCTTTGCCGTGTCGAAGCGTGACTTCATGCGCTTCCAGCTA
GCCGAGTATCTGCCTTGGCTACTAAGGCAGTATCTCTGCGGGGGCCAAGACAAGCCGCCTGTGCTTTACAAGAAC
ATGGTATCAGGACCTGGCCCAACGCCAAATAACGCGAGAACGGCGTACAACATGCCGTCGTATGTCGAGAGCCAG
TCGATGCGTGCTCAACGGTCCCGCACAGGGGAGACGGACAGAATGGAGGCGGGAAGCCGCGGGAATATCGTGGAG
ATGGACAAACCTGTGCGATACAATCAGTACTATTCGCGGGTTCCGGTTCCGCATGGCACGGGTGGCAATGGGAGT
TATCGGCCGGATTCTCCGGGTTGGAATTATCGTTGA
Gene >Ophcf2|03162
ATGACGGACGCAGACCTGGTGACGGACGTCAAAATCTTTGCACACGATCATCTCCCCAACGTCCCTTATGATCGT
GTTCTTCGTGCTGCTCGAGTTGCCAAGGACATTCGTCTATACGATGAGATTGCGCGGAGGACGCGTATCGACGGC
AGTCACCTGCCCGTGCGTCTGACGGATAAAGAGAAGGACGCCCTGTGCAGAGAAAAGGACGTGACGTTTAGCGAA
AAGGGGATGCGCATTGTCATTGCGACTGTGTCGTTGGCGGCTCTCTTACAAGGTCTAGTACTCATCAAACGCCGT
TAGTCGATGACCGCTGACCGTCTTCAAGGGTTTGTTCAGTCATCGTTCAATGGGGCTTCATTGTATGCCGGTGCC
TGGGACCTGGACCTTCATCACAAAGGCCAGGGCGTTACTCTCGACGTCTGGCGTCTCGGAGCGGCCAATGCATCG
CCCTGGATGGTCGCCGCCCTGTTGGGATGTCCGCTCTCGCTGCCCATCAACTACTGGTTCGGCAGACGAGGAGCC
ATCGCCGTGGCAGCCTTTCTGATCCTCGCGAGCTCCATCGGCGCCATCTTCGTCTCCAACTGGAAGCAGATGTTT
TGCGTCCGGATCGTCAATGGCTTGGGTTTGTCTTTTGCTCCCTCGTACCGGATCTGATGATAACCAGATGTCTCG
CAGGCATGGGCATCAAGGCCGTGAGCACTCCTATCCTGGCTTCCGAGACGGCAATCGGCTTCTGGCGCGGCTCGG
CTATACTCGCCTGGCAACTTTGGTATGAATAACACTGATGAAGATGGGCCCAAGGTGGAAGCGCAAGCTAATGAT
GAGCCCTCGTAAAAAGGGTTGCCTTTGGTATTATGGCAGGCTTCGCCTTCAACATGATCTTCAGCATAGCCAAAG
ACGACAGGGTGATTCTCCGTCTGATACAGGGCGCTCCTCTCGTCCCCAGTCTCGCCCTTCTCGTCCTGGCCTTGG
GCTTCTGCCCCGAGTCGCCGCGCTATCACCTCATGAAGGGGCCCAACTATAGCGTTCAAAAGGCACACGAGGCTC
TCAAGAAGGTCAGGAACACCGAGGTACGAGATATGAGCCTCTATATGGCTCCATACACGTCTCACGGTCTCTCAC
GCAGCTCCAAGCCTTACGCGACCTGTACATGGTCTACAAGGCGCTCGAGCAAGAACGAGTCGGGCTTCTCAGCTG
GGATCCGCACGTGTCCTTGTCGCCAGGCTTCTTTTGGGTCATGCGCGATTTCCTCTCCCAGTACGGGCAACTCTT
TCGACGGCGGCGGCTGTACAACGCCCTTTTATCCGCTTGCACAGTCAACCTAGCGCAGCAGCTTTGCGGAGGTGA
GACTAAGGTCTGATGTATGATCCTTTCCACGAGGCTGACGCTATACTTGGTTGTAGTTAACGTTTTCGTCTTCTA
CTCTGGTCCGTTGTCTTCTCAGATTGTCCATCATATTTCTCACGCTCATAATGGTCCTATAGGTTCTCTTTTTAC
TCGAGATGCTGGCTCCGAACCGGACCCCGTGTCTAAACTCAAAGCTATGGCCTATAGTCTAGGTTTCGGTGAGCG
AGATACCAGCGGTCACTAGTTGCTATGCGCTGACATGGAGGCTTCTGTCAGGGGCCATCAACTTCCTCTTTGCTT
TGCCGGCAGTGAAGAGCATTGACACACTCGGTCGACGGAAATGGCTTCTGGCCACGCTGCCTTTCATGTCTCTGT
TCATGCTTGGCGCCGGTCTCTCCTATTTTCTTGGAGACGAAGAGAGTGAGGTCCGGAAAGGGGTGACGGCTGGTT
TCTTATATCGTGCGTATCTCTCTTCATCAGCACCTGGTGCCCTGCCTTACGAATGCTGACTAGCCCCGAGTGTTT
GCTATCGCCTACTCACCTGGCTTGGGCCCGATTCCGTTCACGCTGGCATCGGAAGGCTTTCCGCTGACCCATCGA
GAGGCAGTAAGTCTCCAAGGGCACTCGCATCTTTAAGCTGACCAGGCAAGGGAACATCTTGTGCCATTTCGACCA
ACTTGTTCTTCGCTGGACTGTTATCCATCTGCTACCCAAGGTATGCGCCCCAAAATCGGCTGCTACGGGCGAGTT
GCTAACAATGAGTTCACGCACGCAGAATCGACGTGGCACTCGGTCAGGCCGGATCACTCGGCCTGTTCAGCGGGC
TGAATATTGTGGCCCTTGTACTCGTGTTCCTCTTAGTAGAAGAGACGAAGCAGCTGACGCTTGAAGAGCTCGACC
ACGTCTTTGCCGTGTCGAAGCGTGACTTCATGCGCTTCCAGCTAGCCGAGTATCTGCCTTGGCTACTAAGGCAGT
ATCTCTGCGGGGGCCAAGACAAGCCGCCTGTGCTTTACAAGAACATGGTATCAGGACCTGGCCCAACGCCAAATA
ACGCGAGAACGGCGTACAACATGCCGTCGTATGTCGAGAGCCAGTCGATGCGTGCTCAACGGTCCCGCACAGGGG
AGACGGACAGAATGGAGGCGGGAAGCCGCGGGAATATCGTGGAGATGGACAAACCTGTGCGATACAATCAGTACT
ATTCGCGGGTTCCGGTTCCGCATGGCACGGGTGGCAATGGGAGTTATCGGCCGGATTCTCCGGGTTGGAATTATC
GTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail