Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03150
Gene name
Locationscaffold_03:778483..779965
Strand-
Gene length (bp)1482
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00102 Y_phosphatase Protein-tyrosine phosphatase 9.5E-48 167 421

GO

GO Term Description Terminal node
GO:0006470 protein dephosphorylation Yes
GO:0004725 protein tyrosine phosphatase activity Yes
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0036211 protein modification process No
GO:0042578 phosphoric ester hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0016311 dephosphorylation No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016791 phosphatase activity No
GO:0004721 phosphoprotein phosphatase activity No
GO:0043412 macromolecule modification No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6532 0.5076 0.1896 0.2028 0.1443 0.0228 0.0869 0.101 0.1233 0.0351

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2738
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6844
Ophiocordyceps australis map64 (Brazil) OphauB2|4530
Ophiocordyceps camponoti-floridani Ophcf2|03150 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1135
Ophiocordyceps kimflemingae Ophio5|7513
Ophiocordyceps subramaniannii Hirsu2|4326

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03150
MDKLPRLRRKPKPPAIETSVRKDVTDAHCHHGIFHHHLNHQNSPDATASSPSLSVASPFRSLRIRASAKRARGSA
SPAPSPAVVSPAITLFPSPVRTTFSRTAVAAAQHPEMPAFLSLSTREMDRHYQEITWAERSRLADANTHQSIDDY
KWGHFQQVDGLDRGFMDRYPSIRPWNHNRVRLRVPPGQFDYVNASTVVVPSSSPDSLPPRRYIAMQGPTEPSIDY
VWRMVAEQMPTPAVIVQLTSMEENGVSKCYRYFPDADDAVSTWTLNEDDAWDDGWRAQLTFVSRHYAAEGALEVR
KLHLRVEGEDSPRVVWHFLYRRWPDFGVPAMHHMGAFFDLMRLSRQYAAEDAPRIVHCSAGVGRTGTFICLEHLV
RELETNALDQTANNTDPVFESVELLRQQRRGMVQGEVQYRFLYKVLRRLWRRKHGLDHDDHDDDHDGGDGEPAAK
RIVMADPFTDDEPGKTRPEPPAAAAR*
Coding >Ophcf2|03150
ATGGACAAGCTCCCGCGGCTCCGGCGCAAGCCTAAGCCGCCAGCCATCGAGACATCGGTCCGCAAAGACGTCACC
GACGCCCATTGCCATCATGGCATCTTTCACCACCATCTCAACCACCAAAACTCGCCCGACGCCACCGCTTCTTCG
CCTTCGCTCTCTGTGGCCTCGCCCTTTCGGAGCCTGCGAATACGCGCCTCGGCTAAGCGCGCTCGTGGCTCTGCC
TCGCCCGCCCCGTCACCAGCCGTCGTCTCGCCCGCCATCACCCTCTTCCCTTCACCTGTCCGTACCACATTCTCT
AGAACTGCGGTAGCAGCCGCTCAACATCCGGAGATGCCCGCATTCCTGTCTCTGTCCACTCGGGAAATGGACCGC
CATTATCAGGAAATCACCTGGGCAGAGCGCTCCCGCCTCGCCGACGCCAACACCCACCAGTCCATCGACGACTAC
AAATGGGGTCACTTCCAGCAGGTCGACGGCCTCGACCGCGGCTTCATGGACCGCTATCCCTCGATCCGGCCATGG
AATCACAACCGCGTGCGGCTACGGGTGCCGCCTGGCCAGTTCGACTACGTCAATGCCTCGACCGTCGTCGTGCCA
TCCTCTTCGCCCGACTCGTTGCCCCCGCGTCGCTACATCGCCATGCAAGGCCCAACGGAGCCGTCGATCGATTAC
GTGTGGCGGATGGTGGCCGAACAGATGCCGACGCCAGCCGTCATCGTCCAACTAACGTCGATGGAGGAAAACGGC
GTGAGCAAATGCTATCGATACTTCCCCGACGCCGACGACGCCGTCTCGACCTGGACTCTGAACGAGGACGACGCC
TGGGACGACGGCTGGAGGGCGCAACTGACATTCGTCTCACGCCACTACGCCGCCGAGGGCGCCCTCGAAGTACGG
AAGCTACACCTCCGAGTGGAAGGCGAAGACTCGCCCCGCGTCGTCTGGCACTTCCTCTACCGACGCTGGCCCGAC
TTTGGCGTCCCAGCAATGCACCACATGGGCGCCTTCTTCGACCTAATGCGTCTCTCACGTCAGTACGCAGCAGAA
GACGCCCCCCGCATAGTCCACTGCAGCGCCGGCGTAGGCCGCACAGGAACCTTCATCTGCCTCGAACACCTCGTG
CGCGAACTCGAAACCAACGCCCTCGACCAAACAGCCAACAACACAGACCCCGTCTTCGAATCCGTCGAACTCCTC
CGCCAGCAACGCCGCGGCATGGTCCAGGGCGAAGTCCAATACCGATTCCTCTACAAAGTCCTCCGCCGACTCTGG
CGCCGTAAACACGGCCTCGACCACGACGACCACGACGACGACCACGACGGCGGCGATGGCGAACCCGCGGCCAAG
AGAATCGTCATGGCTGATCCCTTTACCGATGACGAGCCCGGCAAGACTCGTCCCGAGCCTCCGGCCGCGGCTGCG
AGATAG
Transcript >Ophcf2|03150
ATGGACAAGCTCCCGCGGCTCCGGCGCAAGCCTAAGCCGCCAGCCATCGAGACATCGGTCCGCAAAGACGTCACC
GACGCCCATTGCCATCATGGCATCTTTCACCACCATCTCAACCACCAAAACTCGCCCGACGCCACCGCTTCTTCG
CCTTCGCTCTCTGTGGCCTCGCCCTTTCGGAGCCTGCGAATACGCGCCTCGGCTAAGCGCGCTCGTGGCTCTGCC
TCGCCCGCCCCGTCACCAGCCGTCGTCTCGCCCGCCATCACCCTCTTCCCTTCACCTGTCCGTACCACATTCTCT
AGAACTGCGGTAGCAGCCGCTCAACATCCGGAGATGCCCGCATTCCTGTCTCTGTCCACTCGGGAAATGGACCGC
CATTATCAGGAAATCACCTGGGCAGAGCGCTCCCGCCTCGCCGACGCCAACACCCACCAGTCCATCGACGACTAC
AAATGGGGTCACTTCCAGCAGGTCGACGGCCTCGACCGCGGCTTCATGGACCGCTATCCCTCGATCCGGCCATGG
AATCACAACCGCGTGCGGCTACGGGTGCCGCCTGGCCAGTTCGACTACGTCAATGCCTCGACCGTCGTCGTGCCA
TCCTCTTCGCCCGACTCGTTGCCCCCGCGTCGCTACATCGCCATGCAAGGCCCAACGGAGCCGTCGATCGATTAC
GTGTGGCGGATGGTGGCCGAACAGATGCCGACGCCAGCCGTCATCGTCCAACTAACGTCGATGGAGGAAAACGGC
GTGAGCAAATGCTATCGATACTTCCCCGACGCCGACGACGCCGTCTCGACCTGGACTCTGAACGAGGACGACGCC
TGGGACGACGGCTGGAGGGCGCAACTGACATTCGTCTCACGCCACTACGCCGCCGAGGGCGCCCTCGAAGTACGG
AAGCTACACCTCCGAGTGGAAGGCGAAGACTCGCCCCGCGTCGTCTGGCACTTCCTCTACCGACGCTGGCCCGAC
TTTGGCGTCCCAGCAATGCACCACATGGGCGCCTTCTTCGACCTAATGCGTCTCTCACGTCAGTACGCAGCAGAA
GACGCCCCCCGCATAGTCCACTGCAGCGCCGGCGTAGGCCGCACAGGAACCTTCATCTGCCTCGAACACCTCGTG
CGCGAACTCGAAACCAACGCCCTCGACCAAACAGCCAACAACACAGACCCCGTCTTCGAATCCGTCGAACTCCTC
CGCCAGCAACGCCGCGGCATGGTCCAGGGCGAAGTCCAATACCGATTCCTCTACAAAGTCCTCCGCCGACTCTGG
CGCCGTAAACACGGCCTCGACCACGACGACCACGACGACGACCACGACGGCGGCGATGGCGAACCCGCGGCCAAG
AGAATCGTCATGGCTGATCCCTTTACCGATGACGAGCCCGGCAAGACTCGTCCCGAGCCTCCGGCCGCGGCTGCG
AGATAG
Gene >Ophcf2|03150
ATGGACAAGCTCCCGCGGCTCCGGCGCAAGCCTAAGCCGCCAGCCATCGAGACATCGGTCCGCAAAGACGTCACC
GACGCCCATTGCCATCATGGCATCTTTCACCACCATCTCAACCACCAAAACTCGCCCGACGCCACCGCTTCTTCG
CCTTCGCTCTCTGTGGCCTCGCCCTTTCGGAGCCTGCGAATACGCGCCTCGGCTAAGCGCGCTCGTGGCTCTGCC
TCGCCCGCCCCGTCACCAGCCGTCGTCTCGCCCGCCATCACCCTCTTCCCTTCACCTGTCCGTACCACATTCTCT
AGAACTGCGGTAGCAGCCGCTCAACATCCGGAGATGCCCGCATTCCTGTCTCTGTCCACTCGGGGTCTGTTAGCT
CCCGCTCCAATACAAGATAGTGTACTGACGGCCAGCGCAGAAATGGACCGCCATTATCAGGAAATCACCTGGGCA
GAGCGCTCCCGCCTCGCCGACGCCAACACCCACCAGTCCATCGACGACTACAAATGGGGTCACTTCCAGCAGGTC
GACGGCCTCGACCGCGGCTTCATGGACCGCTATCCCTCGATCCGGCCATGGAATCACAACCGCGTGCGGCTACGG
GTGCCGCCTGGCCAGTTCGACTACGTCAATGCCTCGACCGTCGTCGTGCCATCCTCTTCGCCCGACTCGTTGCCC
CCGCGTCGCTACATCGCCATGCAAGGCCCAACGGAGCCGTCGATCGATTACGTGTGGCGGATGGTGGCCGAACAG
ATGCCGACGCCAGCCGTCATCGTCCAACTAACGTCGATGGAGGAAAACGGCGTGAGCAAATGCTATCGATACTTC
CCCGACGCCGACGACGCCGTCTCGACCTGGACTCTGAACGAGGACGACGCCTGGGACGACGGCTGGAGGGCGCAA
CTGACATTCGTCTCACGCCACTACGCCGCCGAGGGCGCCCTCGAAGTACGGAAGCTACACCTCCGAGTGGAAGGC
GAAGACTCGCCCCGCGTCGTCTGGCACTTCCTCTACCGACGCTGGCCCGACTTTGGCGTCCCAGCAATGCACCAC
ATGGGCGCCTTCTTCGACCTAATGCGTCTCTCACGTCAGTACGCAGCAGAAGACGCCCCCCGCATAGTCCACTGC
AGCGCCGGCGTAGGCCGCACAGGAACCTTCATCTGCCTCGAACACCTCGTGCGCGAACTCGAAACCAACGCCCTC
GACCAAACAGCCAACAACACAGACCCCGTCTTCGAATCCGTCGAACTCCTCCGCCAGCAACGCCGCGGCATGGTC
CAGGGCGAAGTCCAATACCGATTCCTCTACAAAGTCCTCCGCCGACTCTGGCGCCGTAAACACGGCCTCGACCAC
GACGACCACGACGACGACCACGACGGCGGCGATGGCGAACCCGCGGCCAAGAGAATCGTCATGGCTGATCCCTTT
ACCGATGACGAGCCCGGCAAGACTCGTCCCGAGCCTCCGGCCGCGGCTGCGAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail