Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03146
Gene name
Locationscaffold_03:768737..769403
Strand+
Gene length (bp)666
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04892 VanZ VanZ like family 5.2E-07 34 110

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 36 53 17
3 60 79 19
4 94 111 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 101.52 53.92 149.11
Alive In ants, during behavior modification 58.83 27.64 90.03
Dead In ants, recently dead 82.45 42.47 122.43

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.010120 yes
Alive Dead 0.080987 no
Dead Fungus 0.357512 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03146
MRIRLPFAGGFVLLLLAAAYAGLSTLQLGHIVNDKVLHTVTFFVLTVVFYWIVDTNRRRTLNMTLIVCTLILGVG
SEFVQSFLPNDRDFDLYDIVANVVGSLAGLGLCSWYHRRMLERRRKRKSYTAVPDEEGVELSPDYEAGLTDDQAQ
PRTLEEEVDNWNENAADDWDGDIVAEASPPIAKAKEPDGHDPAEAKKRTD*
Coding >Ophcf2|03146
ATGCGCATACGCTTGCCTTTTGCTGGCGGCTTCGTACTGTTGCTGCTGGCTGCCGCCTACGCCGGTCTCTCTACC
CTTCAGCTCGGCCACATCGTCAACGACAAGGTCTTGCATACCGTAACCTTCTTCGTCCTCACCGTCGTCTTCTAC
TGGATCGTCGATACAAATCGCCGTCGCACGCTCAACATGACGCTGATCGTCTGTACTCTTATTCTCGGAGTCGGG
TCCGAGTTCGTCCAAAGCTTCCTCCCCAACGACCGCGACTTCGACCTCTACGATATCGTCGCAAACGTGGTGGGT
AGTCTTGCCGGCCTCGGTCTCTGCTCGTGGTATCATAGACGTATGCTTGAGCGACGCAGGAAGCGCAAATCATAC
ACGGCCGTTCCTGACGAGGAGGGTGTCGAGCTGTCTCCGGACTACGAGGCGGGCTTGACCGACGACCAAGCCCAG
CCGAGAACACTCGAGGAAGAGGTTGATAATTGGAACGAGAACGCCGCCGACGACTGGGACGGTGACATCGTCGCC
GAGGCCTCCCCGCCCATCGCCAAGGCCAAGGAACCCGATGGCCACGATCCGGCTGAAGCCAAGAAGCGGACGGAC
TGA
Transcript >Ophcf2|03146
ATGCGCATACGCTTGCCTTTTGCTGGCGGCTTCGTACTGTTGCTGCTGGCTGCCGCCTACGCCGGTCTCTCTACC
CTTCAGCTCGGCCACATCGTCAACGACAAGGTCTTGCATACCGTAACCTTCTTCGTCCTCACCGTCGTCTTCTAC
TGGATCGTCGATACAAATCGCCGTCGCACGCTCAACATGACGCTGATCGTCTGTACTCTTATTCTCGGAGTCGGG
TCCGAGTTCGTCCAAAGCTTCCTCCCCAACGACCGCGACTTCGACCTCTACGATATCGTCGCAAACGTGGTGGGT
AGTCTTGCCGGCCTCGGTCTCTGCTCGTGGTATCATAGACGTATGCTTGAGCGACGCAGGAAGCGCAAATCATAC
ACGGCCGTTCCTGACGAGGAGGGTGTCGAGCTGTCTCCGGACTACGAGGCGGGCTTGACCGACGACCAAGCCCAG
CCGAGAACACTCGAGGAAGAGGTTGATAATTGGAACGAGAACGCCGCCGACGACTGGGACGGTGACATCGTCGCC
GAGGCCTCCCCGCCCATCGCCAAGGCCAAGGAACCCGATGGCCACGATCCGGCTGAAGCCAAGAAGCGGACGGAC
TGA
Gene >Ophcf2|03146
ATGCGCATACGCTTGCCTTTTGCTGGTCAGTATCGAGTGTCGCTTTTTCTAGAGCTTCAGCTTTACTGATGGCGG
CCTTTTCGATCAGGCGGCTTCGTACTGTTGCTGCTGGCTGCCGCCTACGCCGGTCTCTCTACCCTTCAGCTCGGC
CACATCGTCAACGACAAGGTCTTGCATACCGTAACCTTCTTCGTCCTCACCGTCGTCTTCTACTGGATCGTCGAT
ACAAATCGCCGTCGCACGCTCAACATGACGCTGATCGTCTGTACTCTTATTCTCGGAGTCGGGTCCGAGTTCGTC
CAAAGCTTCCTCCCCAACGACCGCGACTTCGACCTCTACGATATCGTCGCAAACGTGGTGGGTAGTCTTGCCGGC
CTCGGTCTCTGCTCGTGGTATCATAGACGTATGCTTGAGCGACGCAGGAAGCGCAAATCATACACGGCCGTTCCT
GACGAGGAGGGTGTCGAGCTGTCTCCGGACTACGAGGCGGGCTTGACCGACGACCAAGCCCAGCCGAGAACACTC
GAGGAAGAGGTTGATAATTGGAACGAGAACGCCGCCGACGACTGGGACGGTGACATCGTCGCCGAGGCCTCCCCG
CCCATCGCCAAGGCCAAGGAACCCGATGGCCACGATCCGGCTGAAGCCAAGAAGCGGACGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail