Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03146
Gene name
Locationscaffold_03:768737..769403
Strand+
Gene length (bp)666
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04892 VanZ VanZ like family 5.2E-07 34 110

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 36 53 17
3 60 79 19
4 94 111 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03146
MRIRLPFAGGFVLLLLAAAYAGLSTLQLGHIVNDKVLHTVTFFVLTVVFYWIVDTNRRRTLNMTLIVCTLILGVG
SEFVQSFLPNDRDFDLYDIVANVVGSLAGLGLCSWYHRRMLERRRKRKSYTAVPDEEGVELSPDYEAGLTDDQAQ
PRTLEEEVDNWNENAADDWDGDIVAEASPPIAKAKEPDGHDPAEAKKRTD*
Coding >Ophcf2|03146
ATGCGCATACGCTTGCCTTTTGCTGGCGGCTTCGTACTGTTGCTGCTGGCTGCCGCCTACGCCGGTCTCTCTACC
CTTCAGCTCGGCCACATCGTCAACGACAAGGTCTTGCATACCGTAACCTTCTTCGTCCTCACCGTCGTCTTCTAC
TGGATCGTCGATACAAATCGCCGTCGCACGCTCAACATGACGCTGATCGTCTGTACTCTTATTCTCGGAGTCGGG
TCCGAGTTCGTCCAAAGCTTCCTCCCCAACGACCGCGACTTCGACCTCTACGATATCGTCGCAAACGTGGTGGGT
AGTCTTGCCGGCCTCGGTCTCTGCTCGTGGTATCATAGACGTATGCTTGAGCGACGCAGGAAGCGCAAATCATAC
ACGGCCGTTCCTGACGAGGAGGGTGTCGAGCTGTCTCCGGACTACGAGGCGGGCTTGACCGACGACCAAGCCCAG
CCGAGAACACTCGAGGAAGAGGTTGATAATTGGAACGAGAACGCCGCCGACGACTGGGACGGTGACATCGTCGCC
GAGGCCTCCCCGCCCATCGCCAAGGCCAAGGAACCCGATGGCCACGATCCGGCTGAAGCCAAGAAGCGGACGGAC
TGA
Transcript >Ophcf2|03146
ATGCGCATACGCTTGCCTTTTGCTGGCGGCTTCGTACTGTTGCTGCTGGCTGCCGCCTACGCCGGTCTCTCTACC
CTTCAGCTCGGCCACATCGTCAACGACAAGGTCTTGCATACCGTAACCTTCTTCGTCCTCACCGTCGTCTTCTAC
TGGATCGTCGATACAAATCGCCGTCGCACGCTCAACATGACGCTGATCGTCTGTACTCTTATTCTCGGAGTCGGG
TCCGAGTTCGTCCAAAGCTTCCTCCCCAACGACCGCGACTTCGACCTCTACGATATCGTCGCAAACGTGGTGGGT
AGTCTTGCCGGCCTCGGTCTCTGCTCGTGGTATCATAGACGTATGCTTGAGCGACGCAGGAAGCGCAAATCATAC
ACGGCCGTTCCTGACGAGGAGGGTGTCGAGCTGTCTCCGGACTACGAGGCGGGCTTGACCGACGACCAAGCCCAG
CCGAGAACACTCGAGGAAGAGGTTGATAATTGGAACGAGAACGCCGCCGACGACTGGGACGGTGACATCGTCGCC
GAGGCCTCCCCGCCCATCGCCAAGGCCAAGGAACCCGATGGCCACGATCCGGCTGAAGCCAAGAAGCGGACGGAC
TGA
Gene >Ophcf2|03146
ATGCGCATACGCTTGCCTTTTGCTGGTCAGTATCGAGTGTCGCTTTTTCTAGAGCTTCAGCTTTACTGATGGCGG
CCTTTTCGATCAGGCGGCTTCGTACTGTTGCTGCTGGCTGCCGCCTACGCCGGTCTCTCTACCCTTCAGCTCGGC
CACATCGTCAACGACAAGGTCTTGCATACCGTAACCTTCTTCGTCCTCACCGTCGTCTTCTACTGGATCGTCGAT
ACAAATCGCCGTCGCACGCTCAACATGACGCTGATCGTCTGTACTCTTATTCTCGGAGTCGGGTCCGAGTTCGTC
CAAAGCTTCCTCCCCAACGACCGCGACTTCGACCTCTACGATATCGTCGCAAACGTGGTGGGTAGTCTTGCCGGC
CTCGGTCTCTGCTCGTGGTATCATAGACGTATGCTTGAGCGACGCAGGAAGCGCAAATCATACACGGCCGTTCCT
GACGAGGAGGGTGTCGAGCTGTCTCCGGACTACGAGGCGGGCTTGACCGACGACCAAGCCCAGCCGAGAACACTC
GAGGAAGAGGTTGATAATTGGAACGAGAACGCCGCCGACGACTGGGACGGTGACATCGTCGCCGAGGCCTCCCCG
CCCATCGCCAAGGCCAAGGAACCCGATGGCCACGATCCGGCTGAAGCCAAGAAGCGGACGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail