Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03144
Gene name
Locationscaffold_03:761193..762882
Strand-
Gene length (bp)1689
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 1.5E-17 129 243
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 9.6E-11 399 542

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 167 189 22
3 202 224 22
4 231 253 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 39.82 22.30 57.33
Alive In ants, during behavior modification 44.88 25.32 64.43
Dead In ants, recently dead 36.01 19.89 52.14

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.584356 no
Alive Dead 0.190649 no
Dead Fungus 0.655784 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03144
MAWTWTIQPPTLTEEAKHHRHTTINLYALTAHASSLTPLLFALVIKLVLVTLTQKTYVPIPTSPSAKAQRLTRAR
RVRDALVRLRWWLDDDVGFGRRDEWLAGIVWLSWLLFLSIHGTGTDFLHFTKRLGAVAVSQLPAQYALSLKALNP
YALAFTSSHERLNRFHGVLGRVIAVLLALHVACYNYFFVVVGIWPSRLLDRVVVYGLVAVVAVLALYLTTLTSVR
RASYRLFFITHVIVALLVPPLIFFHAPSTRIYLIESLLAILADLSVRKLRSITSPSTLNLVPDAALVAIEAHVPP
RFLRSVSASPGSHVYLSIPPGSSRDSSVSRAFDFLHNPFSVAFVDDRRGSITLVARLRQGPMTRTLARLASSAGK
VPLTIDGPYGSVARRLVGWSPSRIVVIAGGVGATFCLPLYRFLREQLPTTTRVRLVWSVRTLADAAWASDAGLLP
PDDEHDDEHDHDHDGFQLYVSGRPLAPALQDTADTDPAVELRPLRKALPPRHHRGRPHLDEVVDSVFRQGVEDSV
AVLVCGPVEMAAHVRGCVRPWAMRGRDVWWHSESFGS*
Coding >Ophcf2|03144
ATGGCCTGGACATGGACAATCCAACCCCCGACCCTCACCGAAGAAGCCAAGCACCATCGCCACACCACAATCAAC
CTCTACGCCCTCACCGCCCACGCCTCCTCCCTCACCCCCCTCCTCTTCGCCCTCGTCATCAAACTCGTCCTCGTC
ACCCTCACGCAGAAAACCTACGTCCCCATCCCCACCTCCCCTTCCGCCAAAGCGCAGCGACTCACACGCGCGAGA
AGGGTTCGCGATGCCCTGGTGCGGCTCCGGTGGTGGCTAGACGATGACGTTGGGTTCGGGCGTCGGGATGAGTGG
TTGGCTGGCATCGTTTGGCTATCATGGCTTCTCTTCCTCAGCATTCACGGGACGGGAACGGATTTCCTGCACTTC
ACAAAGAGATTGGGTGCCGTGGCTGTCTCCCAACTTCCGGCACAGTACGCTCTCTCGCTCAAGGCGTTGAATCCC
TACGCGCTGGCCTTTACGTCGTCGCATGAGCGGCTGAATCGCTTCCACGGCGTGTTGGGCAGGGTCATCGCCGTG
CTGCTTGCTTTGCACGTCGCCTGCTATAATTACTTCTTCGTCGTGGTGGGTATATGGCCTTCTAGATTACTGGAT
CGGGTCGTCGTTTACGGGCTTGTTGCCGTGGTTGCGGTGCTTGCTCTGTACCTTACCACTCTAACCTCGGTTCGA
CGCGCTTCCTATCGCCTCTTTTTCATCACGCACGTCATCGTCGCTCTTCTCGTCCCCCCACTAATCTTCTTCCAC
GCCCCTTCAACAAGAATCTACCTCATCGAATCTCTCCTCGCCATCCTAGCCGATCTATCCGTCCGCAAGCTCCGA
TCCATCACCTCCCCCTCGACGCTCAACCTCGTCCCCGACGCCGCCCTCGTCGCCATCGAGGCACATGTCCCGCCG
CGATTCCTACGCTCCGTATCCGCCTCGCCAGGCTCTCACGTCTATCTCAGCATCCCGCCCGGTAGCAGTCGCGAC
TCGTCCGTATCACGAGCCTTTGATTTTCTCCATAACCCGTTTAGCGTTGCTTTCGTGGACGATAGACGCGGTTCC
ATCACTCTCGTTGCTCGGCTTCGTCAGGGGCCCATGACTCGGACCTTGGCCCGGTTGGCCTCGTCTGCGGGAAAG
GTGCCTCTCACCATAGACGGTCCCTACGGCTCTGTAGCCCGTCGTCTCGTCGGCTGGTCTCCTTCCCGTATCGTC
GTCATCGCAGGCGGCGTCGGCGCAACCTTCTGTCTACCTCTTTACCGCTTCCTACGCGAGCAGCTCCCTACCACC
ACCCGCGTCCGCCTCGTCTGGTCCGTCCGCACCCTCGCCGACGCAGCATGGGCCTCTGACGCCGGACTCCTCCCT
CCCGACGACGAACATGACGATGAACATGACCATGACCATGACGGCTTCCAGCTCTATGTGTCGGGACGCCCTCTC
GCTCCTGCTCTTCAAGACACAGCCGATACCGATCCGGCCGTCGAGCTGCGACCTCTCCGCAAGGCCTTACCGCCC
AGACACCACCGTGGTCGTCCCCATCTGGACGAGGTTGTCGACTCCGTCTTCCGCCAGGGCGTCGAGGACTCCGTT
GCCGTTCTCGTCTGCGGGCCGGTCGAAATGGCTGCCCACGTCAGAGGCTGCGTGCGTCCGTGGGCCATGCGCGGT
AGAGACGTGTGGTGGCACAGCGAGAGCTTCGGCTCATGA
Transcript >Ophcf2|03144
ATGGCCTGGACATGGACAATCCAACCCCCGACCCTCACCGAAGAAGCCAAGCACCATCGCCACACCACAATCAAC
CTCTACGCCCTCACCGCCCACGCCTCCTCCCTCACCCCCCTCCTCTTCGCCCTCGTCATCAAACTCGTCCTCGTC
ACCCTCACGCAGAAAACCTACGTCCCCATCCCCACCTCCCCTTCCGCCAAAGCGCAGCGACTCACACGCGCGAGA
AGGGTTCGCGATGCCCTGGTGCGGCTCCGGTGGTGGCTAGACGATGACGTTGGGTTCGGGCGTCGGGATGAGTGG
TTGGCTGGCATCGTTTGGCTATCATGGCTTCTCTTCCTCAGCATTCACGGGACGGGAACGGATTTCCTGCACTTC
ACAAAGAGATTGGGTGCCGTGGCTGTCTCCCAACTTCCGGCACAGTACGCTCTCTCGCTCAAGGCGTTGAATCCC
TACGCGCTGGCCTTTACGTCGTCGCATGAGCGGCTGAATCGCTTCCACGGCGTGTTGGGCAGGGTCATCGCCGTG
CTGCTTGCTTTGCACGTCGCCTGCTATAATTACTTCTTCGTCGTGGTGGGTATATGGCCTTCTAGATTACTGGAT
CGGGTCGTCGTTTACGGGCTTGTTGCCGTGGTTGCGGTGCTTGCTCTGTACCTTACCACTCTAACCTCGGTTCGA
CGCGCTTCCTATCGCCTCTTTTTCATCACGCACGTCATCGTCGCTCTTCTCGTCCCCCCACTAATCTTCTTCCAC
GCCCCTTCAACAAGAATCTACCTCATCGAATCTCTCCTCGCCATCCTAGCCGATCTATCCGTCCGCAAGCTCCGA
TCCATCACCTCCCCCTCGACGCTCAACCTCGTCCCCGACGCCGCCCTCGTCGCCATCGAGGCACATGTCCCGCCG
CGATTCCTACGCTCCGTATCCGCCTCGCCAGGCTCTCACGTCTATCTCAGCATCCCGCCCGGTAGCAGTCGCGAC
TCGTCCGTATCACGAGCCTTTGATTTTCTCCATAACCCGTTTAGCGTTGCTTTCGTGGACGATAGACGCGGTTCC
ATCACTCTCGTTGCTCGGCTTCGTCAGGGGCCCATGACTCGGACCTTGGCCCGGTTGGCCTCGTCTGCGGGAAAG
GTGCCTCTCACCATAGACGGTCCCTACGGCTCTGTAGCCCGTCGTCTCGTCGGCTGGTCTCCTTCCCGTATCGTC
GTCATCGCAGGCGGCGTCGGCGCAACCTTCTGTCTACCTCTTTACCGCTTCCTACGCGAGCAGCTCCCTACCACC
ACCCGCGTCCGCCTCGTCTGGTCCGTCCGCACCCTCGCCGACGCAGCATGGGCCTCTGACGCCGGACTCCTCCCT
CCCGACGACGAACATGACGATGAACATGACCATGACCATGACGGCTTCCAGCTCTATGTGTCGGGACGCCCTCTC
GCTCCTGCTCTTCAAGACACAGCCGATACCGATCCGGCCGTCGAGCTGCGACCTCTCCGCAAGGCCTTACCGCCC
AGACACCACCGTGGTCGTCCCCATCTGGACGAGGTTGTCGACTCCGTCTTCCGCCAGGGCGTCGAGGACTCCGTT
GCCGTTCTCGTCTGCGGGCCGGTCGAAATGGCTGCCCACGTCAGAGGCTGCGTGCGTCCGTGGGCCATGCGCGGT
AGAGACGTGTGGTGGCACAGCGAGAGCTTCGGCTCATGA
Gene >Ophcf2|03144
ATGGCCTGGACATGGACAATCCAACCCCCGACCCTCACCGAAGAAGCCAAGCACCATCGCCACACCACAATCAAC
CTCTACGCCCTCACCGCCCACGCCTCCTCCCTCACCCCCCTCCTCTTCGCCCTCGTCATCAAACTCGTCCTCGTC
ACCCTCACGCAGAAAACCTACGTCCCCATCCCCACCTCCCCTTCCGCCAAAGCGCAGCGACTCACACGCGCGAGA
AGGGTTCGCGATGCCCTGGTGCGGCTCCGGTGGTGGCTAGACGATGACGTTGGGTTCGGGCGTCGGGATGAGTGG
TTGGCTGGCATCGTTTGGCTATCATGGCTTCTCTTCCTCAGCATTCACGGGACGGGAACGGATTTCCTGCACTTC
ACAAAGAGATTGGGTGCCGTGGCTGTCTCCCAACTTCCGGCACAGTACGCTCTCTCGCTCAAGGCGTTGAATCCC
TACGCGCTGGCCTTTACGTCGTCGCATGAGCGGCTGAATCGCTTCCACGGCGTGTTGGGCAGGGTCATCGCCGTG
CTGCTTGCTTTGCACGTCGCCTGCTATAATTACTTCTTCGTCGTGGTGGGTATATGGCCTTCTAGATTACTGGAT
CGGGTCGTCGTTTACGGGCTTGTTGCCGTGGTTGCGGTGCTTGCTCTGTACCTTACCACTCTAACCTCGGTTCGA
CGCGCTTCCTATCGCCTCTTTTTCATCACGCACGTCATCGTCGCTCTTCTCGTCCCCCCACTAATCTTCTTCCAC
GCCCCTTCAACAAGAATCTACCTCATCGAATCTCTCCTCGCCATCCTAGCCGATCTATCCGTCCGCAAGCTCCGA
TCCATCACCTCCCCCTCGACGCTCAACCTCGTCCCCGACGCCGCCCTCGTCGCCATCGAGGCACATGTCCCGCCG
CGATTCCTACGCTCCGTATCCGCCTCGCCAGGCTCTCACGTCTATCTCAGCATCCCGCCCGGTAGCAGTCGCGAC
TCGTCCGTATCACGAGCCTTTGATTTTCTCCATAACCCGTTTAGCGTTGCTTTCGTGGACGATAGACGCGGTTCC
ATCACTCTCGTTGCTCGGCTTCGTCAGGGGCCCATGACTCGGACCTTGGCCCGGTTGGCCTCGTCTGCGGGAAAG
GTGCCTCTCACCATAGACGGTCCCTACGGCTCTGTAGCCCGTCGTCTCGTCGGCTGGTCTCCTTCCCGTATCGTC
GTCATCGCAGGCGGCGTCGGCGCAACCTTCTGTCTACCTCTTTACCGCTTCCTACGCGAGCAGCTCCCTACCACC
ACCCGCGTCCGCCTCGTCTGGTCCGTCCGCACCCTCGCCGACGCAGCATGGGCCTCTGACGCCGGACTCCTCCCT
CCCGACGACGAACATGACGATGAACATGACCATGACCATGACGGCTTCCAGCTCTATGTGTCGGGACGCCCTCTC
GCTCCTGCTCTTCAAGACACAGCCGATACCGATCCGGCCGTCGAGCTGCGACCTCTCCGCAAGGCCTTACCGCCC
AGACACCACCGTGGTCGTCCCCATCTGGACGAGGTTGTCGACTCCGTCTTCCGCCAGGGCGTCGAGGACTCCGTT
GCCGTTCTCGTCTGCGGGCCGGTCGAAATGGCTGCCCACGTCAGAGGCTGCGTGCGTCCGTGGGCCATGCGCGGT
AGAGACGTGTGGTGGCACAGCGAGAGCTTCGGCTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail