Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03137
Gene name
Locationscaffold_03:747619..749524
Strand-
Gene length (bp)1905
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 8.0E-32 422 570
PF08022 FAD_binding_8 FAD-binding domain 4.5E-19 291 415
PF01794 Ferric_reduct Ferric reductase like transmembrane component 4.6E-18 114 232

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 97 119 22
3 140 162 22
4 177 199 22
5 220 242 22
6 252 274 22
7 313 332 19
8 424 446 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 3.36 0.94 5.78
Alive In ants, during behavior modification 6.21 2.23 10.19
Dead In ants, recently dead 5.40 1.87 8.93

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.037049 yes
Alive Dead 0.606252 no
Dead Fungus 0.113262 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03137
MDPFNDVEYEYDYEKPSERSRWSPLTRMLLSGEMTQEKQSSLTTREKFDRWMINEGYRRIFVFVFMLAHALIFAF
ASVHYALKDSLQGARDTFGVTYIIARSSAVVLHVDVGIVLFPVCRTLISLLRQTPLNGIIQFDKNITFHIMTAWS
IVFWSWVHTIAHWVNFGQAAAKNRLGFYGWLVANFASGPGWTGYVMLIALMGMVATSVEKPRRANYERFWYTHHF
FIIFFLFWSFHGAFCMIQPDVAPFCVGTGASAIGVFWQYWMYSGFLYLGERIAREIRGRHYTVISKVIQHPSQVC
EIQIKKEHTKTRAGQYIFLCCPAVSIWQYHPFTLTSAPEEDYISVHVRCQGDFTMALSQALGCEWGKKESSSSSS
SSSTEDTSKVVGVEAENTVVDPALRRVLPRVYIDGPFGSASEDVFKYEVSILVGAGIGVTPFASILKSIWYRMNY
PTTKTRLSKVYFFWICRDFGSFEWFRSLLLAVEAQDVEHRIEIHTYLTAKIKADDATNIMINDANADKDTITGLR
SPTSFGRPNWDMIFRGIRKLHAPGEAGVFFCGPKGLGSSLHVYCNKYTEPGFSFVWGKENF*
Coding >Ophcf2|03137
ATGGATCCTTTCAACGACGTCGAGTACGAGTATGACTATGAGAAGCCGTCGGAGAGGTCGAGATGGTCGCCTTTG
ACGCGGATGCTGTTGTCGGGGGAGATGACGCAGGAGAAGCAGTCGTCGCTGACGACGAGGGAAAAGTTTGACCGC
TGGATGATCAACGAGGGGTATCGGCGCATCTTCGTCTTCGTCTTCATGCTTGCTCACGCCCTCATCTTCGCATTT
GCTTCGGTTCATTACGCGCTCAAGGATAGTCTTCAGGGCGCGAGAGATACGTTTGGTGTGACTTACATCATCGCC
CGGTCTTCGGCTGTGGTGCTGCACGTTGACGTTGGCATCGTCCTTTTTCCCGTCTGCCGGACGCTCATCTCGTTA
CTTCGACAGACGCCGCTCAACGGGATCATCCAGTTCGATAAGAACATTACCTTTCACATCATGACGGCCTGGTCC
ATCGTCTTCTGGTCTTGGGTCCATACCATTGCTCATTGGGTCAACTTTGGTCAGGCGGCTGCCAAGAATCGACTC
GGCTTCTACGGCTGGCTCGTGGCCAACTTTGCGTCCGGGCCAGGATGGACGGGATACGTCATGCTCATTGCTCTG
ATGGGCATGGTGGCGACTTCGGTAGAGAAGCCGCGTCGGGCCAACTACGAGCGGTTCTGGTATACCCATCACTTC
TTCATCATCTTCTTCCTCTTCTGGTCCTTTCACGGCGCTTTCTGCATGATTCAGCCTGACGTTGCTCCCTTTTGC
GTCGGGACTGGCGCCTCGGCCATTGGAGTCTTCTGGCAGTATTGGATGTACAGCGGTTTCCTCTACCTGGGAGAG
CGCATCGCCCGTGAGATTCGCGGTCGTCATTACACCGTCATCTCCAAGGTCATCCAGCATCCGAGCCAGGTGTGC
GAGATTCAGATCAAAAAGGAGCACACCAAGACGCGGGCCGGACAGTACATCTTCCTATGCTGCCCGGCCGTCTCT
ATCTGGCAGTACCATCCCTTTACACTGACGAGCGCCCCCGAGGAGGATTACATCTCGGTTCATGTCCGCTGTCAG
GGAGACTTTACCATGGCGCTGTCGCAGGCTCTCGGGTGCGAATGGGGGAAGAAGGAGTCGTCGTCGTCTTCTTCT
TCCTCTTCTACCGAGGATACGAGCAAGGTGGTGGGCGTCGAGGCGGAGAATACAGTCGTCGATCCGGCGCTGAGA
CGCGTCCTGCCGCGCGTTTACATCGACGGACCCTTTGGTTCCGCGTCCGAGGATGTCTTCAAGTACGAGGTTTCG
ATTCTGGTCGGCGCCGGCATAGGCGTTACGCCTTTTGCCTCGATCCTCAAGTCCATCTGGTACCGGATGAACTAC
CCGACGACGAAGACGCGACTGTCAAAGGTCTACTTCTTCTGGATCTGCCGCGACTTTGGCTCCTTCGAGTGGTTC
CGCTCCCTATTGCTAGCCGTCGAAGCGCAAGACGTCGAGCACCGAATCGAGATCCATACCTATCTGACAGCCAAG
ATCAAGGCCGACGACGCGACCAACATCATGATCAACGACGCAAACGCCGACAAGGATACCATTACCGGTCTGCGC
AGCCCTACGAGCTTCGGCCGGCCGAACTGGGATATGATCTTTCGGGGGATCCGCAAGTTGCACGCTCCCGGCGAG
GCTGGCGTTTTCTTCTGCGGGCCAAAGGGGTTGGGTAGCTCGTTGCACGTCTACTGCAATAAGTATACGGAGCCT
GGCTTCTCTTTCGTCTGGGGCAAGGAGAACTTTTAA
Transcript >Ophcf2|03137
ATGGATCCTTTCAACGACGTCGAGTACGAGTATGACTATGAGAAGCCGTCGGAGAGGTCGAGATGGTCGCCTTTG
ACGCGGATGCTGTTGTCGGGGGAGATGACGCAGGAGAAGCAGTCGTCGCTGACGACGAGGGAAAAGTTTGACCGC
TGGATGATCAACGAGGGGTATCGGCGCATCTTCGTCTTCGTCTTCATGCTTGCTCACGCCCTCATCTTCGCATTT
GCTTCGGTTCATTACGCGCTCAAGGATAGTCTTCAGGGCGCGAGAGATACGTTTGGTGTGACTTACATCATCGCC
CGGTCTTCGGCTGTGGTGCTGCACGTTGACGTTGGCATCGTCCTTTTTCCCGTCTGCCGGACGCTCATCTCGTTA
CTTCGACAGACGCCGCTCAACGGGATCATCCAGTTCGATAAGAACATTACCTTTCACATCATGACGGCCTGGTCC
ATCGTCTTCTGGTCTTGGGTCCATACCATTGCTCATTGGGTCAACTTTGGTCAGGCGGCTGCCAAGAATCGACTC
GGCTTCTACGGCTGGCTCGTGGCCAACTTTGCGTCCGGGCCAGGATGGACGGGATACGTCATGCTCATTGCTCTG
ATGGGCATGGTGGCGACTTCGGTAGAGAAGCCGCGTCGGGCCAACTACGAGCGGTTCTGGTATACCCATCACTTC
TTCATCATCTTCTTCCTCTTCTGGTCCTTTCACGGCGCTTTCTGCATGATTCAGCCTGACGTTGCTCCCTTTTGC
GTCGGGACTGGCGCCTCGGCCATTGGAGTCTTCTGGCAGTATTGGATGTACAGCGGTTTCCTCTACCTGGGAGAG
CGCATCGCCCGTGAGATTCGCGGTCGTCATTACACCGTCATCTCCAAGGTCATCCAGCATCCGAGCCAGGTGTGC
GAGATTCAGATCAAAAAGGAGCACACCAAGACGCGGGCCGGACAGTACATCTTCCTATGCTGCCCGGCCGTCTCT
ATCTGGCAGTACCATCCCTTTACACTGACGAGCGCCCCCGAGGAGGATTACATCTCGGTTCATGTCCGCTGTCAG
GGAGACTTTACCATGGCGCTGTCGCAGGCTCTCGGGTGCGAATGGGGGAAGAAGGAGTCGTCGTCGTCTTCTTCT
TCCTCTTCTACCGAGGATACGAGCAAGGTGGTGGGCGTCGAGGCGGAGAATACAGTCGTCGATCCGGCGCTGAGA
CGCGTCCTGCCGCGCGTTTACATCGACGGACCCTTTGGTTCCGCGTCCGAGGATGTCTTCAAGTACGAGGTTTCG
ATTCTGGTCGGCGCCGGCATAGGCGTTACGCCTTTTGCCTCGATCCTCAAGTCCATCTGGTACCGGATGAACTAC
CCGACGACGAAGACGCGACTGTCAAAGGTCTACTTCTTCTGGATCTGCCGCGACTTTGGCTCCTTCGAGTGGTTC
CGCTCCCTATTGCTAGCCGTCGAAGCGCAAGACGTCGAGCACCGAATCGAGATCCATACCTATCTGACAGCCAAG
ATCAAGGCCGACGACGCGACCAACATCATGATCAACGACGCAAACGCCGACAAGGATACCATTACCGGTCTGCGC
AGCCCTACGAGCTTCGGCCGGCCGAACTGGGATATGATCTTTCGGGGGATCCGCAAGTTGCACGCTCCCGGCGAG
GCTGGCGTTTTCTTCTGCGGGCCAAAGGGGTTGGGTAGCTCGTTGCACGTCTACTGCAATAAGTATACGGAGCCT
GGCTTCTCTTTCGTCTGGGGCAAGGAGAACTTTTAA
Gene >Ophcf2|03137
ATGGATCCTTTCAACGACGTCGAGTACGAGTATGACTATGAGAAGCCGTCGGAGAGGTCGAGATGGTCGCCTTTG
ACGCGGATGCTGTTGTCGGGGGAGATGACGCAGGAGAAGCAGTCGTCGCTGACGACGAGGGAAAAGTTTGACCGC
TGGATGATCAACGAGGGGTATCGGCGCATGTGAGTTCTCGAGGAGTTGATGGGCGGTTGTTGGTGTTGGTTGGGG
CTGACTGGGTTGTTTAGCTTCGTCTTCGTCTTCATGCTTGCTCACGCCCTCATCTTCGCATTTGCTTCGGTTCAT
TACGCGCTCAAGGATAGTCTTCAGGGCGCGAGAGATACGTTTGGTGTGACTTACATCATCGCCCGGTCTTCGGCT
GTGGTGCTGCACGTTGACGTTGGCATCGTCCTTTTTCCCGTCTGCCGGACGCTCATCTCGTTACTTCGACAGACG
CCGCTCAACGGGATCATCCAGTTCGATAAGAACATTACCTTTCACATCATGACGGCCTGGTCCATCGTCTTCTGG
TCTTGGGTCCATACCATTGCTCATTGGGTCAACTTTGGTCAGGCGGCTGCCAAGAATCGACTCGGCTTCTACGGC
TGGCTCGTGGCCAACTTTGCGTCCGGGCCAGGATGGACGGGATACGTCATGCTCATTGCTCTGATGGGCATGGTG
GCGACTTCGGTAGAGAAGCCGCGTCGGGCCAACTACGAGCGGTTCTGGTATACCCATCACTTCTTCATCATCTTC
TTCCTCTTCTGGTCCTTTCACGGCGCTTTCTGCATGATTCAGCCTGACGTTGCTCCCTTTTGCGTCGGGACTGGC
GCCTCGGCCATTGGAGTCTTCTGGCAGTATTGGATGTACAGCGGTTTCCTCTACCTGGGAGAGCGCATCGCCCGT
GAGATTCGCGGTCGTCATTACACCGTCATCTCCAAGGTCATCCAGCATCCGAGCCAGGTGTGCGAGATTCAGATC
AAAAAGGAGCACACCAAGACGCGGGCCGGACAGTACATCTTCCTATGCTGCCCGGCCGTCTCTATCTGGCAGTAC
CATCCCTTTACACTGACGAGCGCCCCCGAGGAGGATTACATCTCGGTTCATGTCCGCTGTCAGGGAGACTTTACC
ATGGCGCTGTCGCAGGCTCTCGGGTGCGAATGGGGGAAGAAGGAGTCGTCGTCGTCTTCTTCTTCCTCTTCTACC
GAGGATACGAGCAAGGTGGTGGGCGTCGAGGCGGAGAATACAGTCGTCGATCCGGCGCTGAGACGCGTCCTGCCG
CGCGTTTACATCGACGGACCCTTTGGTTCCGCGTCCGAGGATGTCTTCAAGTACGAGGTTTCGATTCTGGTCGGC
GCCGGCATAGGCGTTACGCCTTTTGCCTCGATCCTCAAGTCCATCTGGTACCGGATGAACTACCCGACGACGAAG
ACGCGACTGTCAAAGGTCTACTTCTTCTGGATCTGCCGCGACTTTGGCTCCTTCGAGTGGTTCCGCTCCCTATTG
CTAGCCGTCGAAGCGCAAGACGTCGAGCACCGAATCGAGATCCATACCTATCTGACAGCCAAGATCAAGGCCGAC
GACGCGACCAACATCATGATCAACGACGCAAACGCCGACAAGGATACCATTACCGGTCTGCGCAGCCCTACGAGC
TTCGGCCGGCCGAACTGGGATATGATCTTTCGGGGGATCCGCAAGTTGCACGCTCCCGGCGAGGCTGGCGTTTTC
TTCTGCGGGCCAAAGGGGTTGGGTAGCTCGTTGCACGTCTACTGCAATAAGTATACGGAGCCTGGGTGAGTTCCG
GATCCCCTCCTTTTTGGTGTTTGCTGCGTTGTTTGTTGTTTGTCTCGCCTGGCTGACCGTCTTTCTTTTAGCTTC
TCTTTCGTCTGGGGCAAGGAGAACTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail