Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03137
Gene name
Locationscaffold_03:747619..749524
Strand-
Gene length (bp)1905
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 8.0E-32 422 570
PF08022 FAD_binding_8 FAD-binding domain 4.5E-19 291 415
PF01794 Ferric_reduct Ferric reductase like transmembrane component 4.6E-18 114 232

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 97 119 22
3 140 162 22
4 177 199 22
5 220 242 22
6 252 274 22
7 313 332 19
8 424 446 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03137
MDPFNDVEYEYDYEKPSERSRWSPLTRMLLSGEMTQEKQSSLTTREKFDRWMINEGYRRIFVFVFMLAHALIFAF
ASVHYALKDSLQGARDTFGVTYIIARSSAVVLHVDVGIVLFPVCRTLISLLRQTPLNGIIQFDKNITFHIMTAWS
IVFWSWVHTIAHWVNFGQAAAKNRLGFYGWLVANFASGPGWTGYVMLIALMGMVATSVEKPRRANYERFWYTHHF
FIIFFLFWSFHGAFCMIQPDVAPFCVGTGASAIGVFWQYWMYSGFLYLGERIAREIRGRHYTVISKVIQHPSQVC
EIQIKKEHTKTRAGQYIFLCCPAVSIWQYHPFTLTSAPEEDYISVHVRCQGDFTMALSQALGCEWGKKESSSSSS
SSSTEDTSKVVGVEAENTVVDPALRRVLPRVYIDGPFGSASEDVFKYEVSILVGAGIGVTPFASILKSIWYRMNY
PTTKTRLSKVYFFWICRDFGSFEWFRSLLLAVEAQDVEHRIEIHTYLTAKIKADDATNIMINDANADKDTITGLR
SPTSFGRPNWDMIFRGIRKLHAPGEAGVFFCGPKGLGSSLHVYCNKYTEPGFSFVWGKENF*
Coding >Ophcf2|03137
ATGGATCCTTTCAACGACGTCGAGTACGAGTATGACTATGAGAAGCCGTCGGAGAGGTCGAGATGGTCGCCTTTG
ACGCGGATGCTGTTGTCGGGGGAGATGACGCAGGAGAAGCAGTCGTCGCTGACGACGAGGGAAAAGTTTGACCGC
TGGATGATCAACGAGGGGTATCGGCGCATCTTCGTCTTCGTCTTCATGCTTGCTCACGCCCTCATCTTCGCATTT
GCTTCGGTTCATTACGCGCTCAAGGATAGTCTTCAGGGCGCGAGAGATACGTTTGGTGTGACTTACATCATCGCC
CGGTCTTCGGCTGTGGTGCTGCACGTTGACGTTGGCATCGTCCTTTTTCCCGTCTGCCGGACGCTCATCTCGTTA
CTTCGACAGACGCCGCTCAACGGGATCATCCAGTTCGATAAGAACATTACCTTTCACATCATGACGGCCTGGTCC
ATCGTCTTCTGGTCTTGGGTCCATACCATTGCTCATTGGGTCAACTTTGGTCAGGCGGCTGCCAAGAATCGACTC
GGCTTCTACGGCTGGCTCGTGGCCAACTTTGCGTCCGGGCCAGGATGGACGGGATACGTCATGCTCATTGCTCTG
ATGGGCATGGTGGCGACTTCGGTAGAGAAGCCGCGTCGGGCCAACTACGAGCGGTTCTGGTATACCCATCACTTC
TTCATCATCTTCTTCCTCTTCTGGTCCTTTCACGGCGCTTTCTGCATGATTCAGCCTGACGTTGCTCCCTTTTGC
GTCGGGACTGGCGCCTCGGCCATTGGAGTCTTCTGGCAGTATTGGATGTACAGCGGTTTCCTCTACCTGGGAGAG
CGCATCGCCCGTGAGATTCGCGGTCGTCATTACACCGTCATCTCCAAGGTCATCCAGCATCCGAGCCAGGTGTGC
GAGATTCAGATCAAAAAGGAGCACACCAAGACGCGGGCCGGACAGTACATCTTCCTATGCTGCCCGGCCGTCTCT
ATCTGGCAGTACCATCCCTTTACACTGACGAGCGCCCCCGAGGAGGATTACATCTCGGTTCATGTCCGCTGTCAG
GGAGACTTTACCATGGCGCTGTCGCAGGCTCTCGGGTGCGAATGGGGGAAGAAGGAGTCGTCGTCGTCTTCTTCT
TCCTCTTCTACCGAGGATACGAGCAAGGTGGTGGGCGTCGAGGCGGAGAATACAGTCGTCGATCCGGCGCTGAGA
CGCGTCCTGCCGCGCGTTTACATCGACGGACCCTTTGGTTCCGCGTCCGAGGATGTCTTCAAGTACGAGGTTTCG
ATTCTGGTCGGCGCCGGCATAGGCGTTACGCCTTTTGCCTCGATCCTCAAGTCCATCTGGTACCGGATGAACTAC
CCGACGACGAAGACGCGACTGTCAAAGGTCTACTTCTTCTGGATCTGCCGCGACTTTGGCTCCTTCGAGTGGTTC
CGCTCCCTATTGCTAGCCGTCGAAGCGCAAGACGTCGAGCACCGAATCGAGATCCATACCTATCTGACAGCCAAG
ATCAAGGCCGACGACGCGACCAACATCATGATCAACGACGCAAACGCCGACAAGGATACCATTACCGGTCTGCGC
AGCCCTACGAGCTTCGGCCGGCCGAACTGGGATATGATCTTTCGGGGGATCCGCAAGTTGCACGCTCCCGGCGAG
GCTGGCGTTTTCTTCTGCGGGCCAAAGGGGTTGGGTAGCTCGTTGCACGTCTACTGCAATAAGTATACGGAGCCT
GGCTTCTCTTTCGTCTGGGGCAAGGAGAACTTTTAA
Transcript >Ophcf2|03137
ATGGATCCTTTCAACGACGTCGAGTACGAGTATGACTATGAGAAGCCGTCGGAGAGGTCGAGATGGTCGCCTTTG
ACGCGGATGCTGTTGTCGGGGGAGATGACGCAGGAGAAGCAGTCGTCGCTGACGACGAGGGAAAAGTTTGACCGC
TGGATGATCAACGAGGGGTATCGGCGCATCTTCGTCTTCGTCTTCATGCTTGCTCACGCCCTCATCTTCGCATTT
GCTTCGGTTCATTACGCGCTCAAGGATAGTCTTCAGGGCGCGAGAGATACGTTTGGTGTGACTTACATCATCGCC
CGGTCTTCGGCTGTGGTGCTGCACGTTGACGTTGGCATCGTCCTTTTTCCCGTCTGCCGGACGCTCATCTCGTTA
CTTCGACAGACGCCGCTCAACGGGATCATCCAGTTCGATAAGAACATTACCTTTCACATCATGACGGCCTGGTCC
ATCGTCTTCTGGTCTTGGGTCCATACCATTGCTCATTGGGTCAACTTTGGTCAGGCGGCTGCCAAGAATCGACTC
GGCTTCTACGGCTGGCTCGTGGCCAACTTTGCGTCCGGGCCAGGATGGACGGGATACGTCATGCTCATTGCTCTG
ATGGGCATGGTGGCGACTTCGGTAGAGAAGCCGCGTCGGGCCAACTACGAGCGGTTCTGGTATACCCATCACTTC
TTCATCATCTTCTTCCTCTTCTGGTCCTTTCACGGCGCTTTCTGCATGATTCAGCCTGACGTTGCTCCCTTTTGC
GTCGGGACTGGCGCCTCGGCCATTGGAGTCTTCTGGCAGTATTGGATGTACAGCGGTTTCCTCTACCTGGGAGAG
CGCATCGCCCGTGAGATTCGCGGTCGTCATTACACCGTCATCTCCAAGGTCATCCAGCATCCGAGCCAGGTGTGC
GAGATTCAGATCAAAAAGGAGCACACCAAGACGCGGGCCGGACAGTACATCTTCCTATGCTGCCCGGCCGTCTCT
ATCTGGCAGTACCATCCCTTTACACTGACGAGCGCCCCCGAGGAGGATTACATCTCGGTTCATGTCCGCTGTCAG
GGAGACTTTACCATGGCGCTGTCGCAGGCTCTCGGGTGCGAATGGGGGAAGAAGGAGTCGTCGTCGTCTTCTTCT
TCCTCTTCTACCGAGGATACGAGCAAGGTGGTGGGCGTCGAGGCGGAGAATACAGTCGTCGATCCGGCGCTGAGA
CGCGTCCTGCCGCGCGTTTACATCGACGGACCCTTTGGTTCCGCGTCCGAGGATGTCTTCAAGTACGAGGTTTCG
ATTCTGGTCGGCGCCGGCATAGGCGTTACGCCTTTTGCCTCGATCCTCAAGTCCATCTGGTACCGGATGAACTAC
CCGACGACGAAGACGCGACTGTCAAAGGTCTACTTCTTCTGGATCTGCCGCGACTTTGGCTCCTTCGAGTGGTTC
CGCTCCCTATTGCTAGCCGTCGAAGCGCAAGACGTCGAGCACCGAATCGAGATCCATACCTATCTGACAGCCAAG
ATCAAGGCCGACGACGCGACCAACATCATGATCAACGACGCAAACGCCGACAAGGATACCATTACCGGTCTGCGC
AGCCCTACGAGCTTCGGCCGGCCGAACTGGGATATGATCTTTCGGGGGATCCGCAAGTTGCACGCTCCCGGCGAG
GCTGGCGTTTTCTTCTGCGGGCCAAAGGGGTTGGGTAGCTCGTTGCACGTCTACTGCAATAAGTATACGGAGCCT
GGCTTCTCTTTCGTCTGGGGCAAGGAGAACTTTTAA
Gene >Ophcf2|03137
ATGGATCCTTTCAACGACGTCGAGTACGAGTATGACTATGAGAAGCCGTCGGAGAGGTCGAGATGGTCGCCTTTG
ACGCGGATGCTGTTGTCGGGGGAGATGACGCAGGAGAAGCAGTCGTCGCTGACGACGAGGGAAAAGTTTGACCGC
TGGATGATCAACGAGGGGTATCGGCGCATGTGAGTTCTCGAGGAGTTGATGGGCGGTTGTTGGTGTTGGTTGGGG
CTGACTGGGTTGTTTAGCTTCGTCTTCGTCTTCATGCTTGCTCACGCCCTCATCTTCGCATTTGCTTCGGTTCAT
TACGCGCTCAAGGATAGTCTTCAGGGCGCGAGAGATACGTTTGGTGTGACTTACATCATCGCCCGGTCTTCGGCT
GTGGTGCTGCACGTTGACGTTGGCATCGTCCTTTTTCCCGTCTGCCGGACGCTCATCTCGTTACTTCGACAGACG
CCGCTCAACGGGATCATCCAGTTCGATAAGAACATTACCTTTCACATCATGACGGCCTGGTCCATCGTCTTCTGG
TCTTGGGTCCATACCATTGCTCATTGGGTCAACTTTGGTCAGGCGGCTGCCAAGAATCGACTCGGCTTCTACGGC
TGGCTCGTGGCCAACTTTGCGTCCGGGCCAGGATGGACGGGATACGTCATGCTCATTGCTCTGATGGGCATGGTG
GCGACTTCGGTAGAGAAGCCGCGTCGGGCCAACTACGAGCGGTTCTGGTATACCCATCACTTCTTCATCATCTTC
TTCCTCTTCTGGTCCTTTCACGGCGCTTTCTGCATGATTCAGCCTGACGTTGCTCCCTTTTGCGTCGGGACTGGC
GCCTCGGCCATTGGAGTCTTCTGGCAGTATTGGATGTACAGCGGTTTCCTCTACCTGGGAGAGCGCATCGCCCGT
GAGATTCGCGGTCGTCATTACACCGTCATCTCCAAGGTCATCCAGCATCCGAGCCAGGTGTGCGAGATTCAGATC
AAAAAGGAGCACACCAAGACGCGGGCCGGACAGTACATCTTCCTATGCTGCCCGGCCGTCTCTATCTGGCAGTAC
CATCCCTTTACACTGACGAGCGCCCCCGAGGAGGATTACATCTCGGTTCATGTCCGCTGTCAGGGAGACTTTACC
ATGGCGCTGTCGCAGGCTCTCGGGTGCGAATGGGGGAAGAAGGAGTCGTCGTCGTCTTCTTCTTCCTCTTCTACC
GAGGATACGAGCAAGGTGGTGGGCGTCGAGGCGGAGAATACAGTCGTCGATCCGGCGCTGAGACGCGTCCTGCCG
CGCGTTTACATCGACGGACCCTTTGGTTCCGCGTCCGAGGATGTCTTCAAGTACGAGGTTTCGATTCTGGTCGGC
GCCGGCATAGGCGTTACGCCTTTTGCCTCGATCCTCAAGTCCATCTGGTACCGGATGAACTACCCGACGACGAAG
ACGCGACTGTCAAAGGTCTACTTCTTCTGGATCTGCCGCGACTTTGGCTCCTTCGAGTGGTTCCGCTCCCTATTG
CTAGCCGTCGAAGCGCAAGACGTCGAGCACCGAATCGAGATCCATACCTATCTGACAGCCAAGATCAAGGCCGAC
GACGCGACCAACATCATGATCAACGACGCAAACGCCGACAAGGATACCATTACCGGTCTGCGCAGCCCTACGAGC
TTCGGCCGGCCGAACTGGGATATGATCTTTCGGGGGATCCGCAAGTTGCACGCTCCCGGCGAGGCTGGCGTTTTC
TTCTGCGGGCCAAAGGGGTTGGGTAGCTCGTTGCACGTCTACTGCAATAAGTATACGGAGCCTGGGTGAGTTCCG
GATCCCCTCCTTTTTGGTGTTTGCTGCGTTGTTTGTTGTTTGTCTCGCCTGGCTGACCGTCTTTCTTTTAGCTTC
TCTTTCGTCTGGGGCAAGGAGAACTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail