Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03131
Gene name
Locationscaffold_03:734919..736429
Strand+
Gene length (bp)1510
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11951 Fungal_trans_2 Fungal specific transcription factor domain 3.2E-37 48 480

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5734 0.7337 0.0339 0.0472 0.179 0.0577 0.0741 0.0686 0.0607 0.0618

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 3.69 0.99 6.39
Alive In ants, during behavior modification 15.53 6.88 24.17
Dead In ants, recently dead 17.64 8.23 27.05

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.589559 no
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup891
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1571
Ophiocordyceps australis map64 (Brazil) OphauB2|4549
Ophiocordyceps camponoti-floridani Ophcf2|03131 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3833
Ophiocordyceps camponoti-rufipedis Ophun1|3834
Ophiocordyceps kimflemingae Ophio5|3076
Ophiocordyceps subramaniannii Hirsu2|5622

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03131
MCEGYHEKQLWKSGRERAEGDGRRGECLPTVTMPPLIHGVETSEDRILWRHYVSHLSNVLTVEGEAKNAFKDVIL
QLANQHQGLMHSVLALSSRHMDLSSPYGVRVLQSHAGTSRESLQRRAEHHHAEALKRLYEDLEKSLGKDDPEYQT
MLAGRYGQILCLLLQTRTDGNPRGEHRLHLQAYQSLIQQSPPGDAAFYTFVTEFFQYHVYTDDLLWHPSMMTRRL
STESWQPSTPTESPRLLGVADGLFRQLSHINSVRNAIRDKMASSSSSAYPMVDHAILSRAVDIEASIKEWSPRWP
PGDSRNRVAPLYRQVMWVYLFRTIYPPCRPSPGTTAPTPSPQPPETRRRDPPRKPRHPSPSPEEAKTGSDEPPQN
PVPTDGRITLAVNESISILESFRPSDPIQTLLLVPCLLIGTACFHPRQRRRIRSSVGLVRSYTGLRSCDRAAELL
EALWSLMDEGQWMAVWDWQGVARGMGLDFLCA*
Coding >Ophcf2|03131
ATGTGCGAGGGCTATCACGAGAAGCAGCTGTGGAAGAGCGGAAGAGAGAGGGCAGAAGGTGACGGACGAAGGGGC
GAGTGCCTACCAACTGTGACGATGCCGCCTCTCATCCACGGCGTCGAGACGAGCGAAGATAGAATACTATGGCGA
CACTACGTCAGTCACCTCAGCAACGTCCTGACGGTCGAGGGCGAGGCCAAGAACGCCTTCAAGGACGTCATCCTG
CAGCTCGCCAACCAGCATCAGGGCCTGATGCACTCGGTGCTGGCCCTGAGCAGCAGGCACATGGACCTCAGCTCC
CCCTACGGCGTCCGCGTGCTCCAGAGCCACGCGGGCACGAGCCGCGAGTCCCTCCAGCGACGGGCCGAACACCAC
CACGCCGAGGCGCTGAAGCGGCTTTACGAAGACCTGGAGAAGTCGCTGGGCAAGGACGATCCCGAGTACCAGACG
ATGCTCGCCGGTCGATACGGTCAAATCCTCTGCCTCCTCCTCCAGACGAGGACGGACGGCAACCCGCGAGGCGAG
CACAGGCTTCACCTCCAGGCTTATCAGAGCCTGATCCAGCAGTCGCCGCCAGGAGACGCGGCCTTTTATACGTTC
GTCACCGAGTTCTTCCAGTACCACGTCTACACAGACGATCTCCTCTGGCACCCGAGCATGATGACGCGGCGGCTA
TCGACGGAAAGCTGGCAGCCGTCCACCCCGACGGAATCCCCCCGTCTCCTGGGCGTAGCAGACGGCCTCTTCAGA
CAACTCTCCCACATCAACAGCGTCCGCAACGCCATCCGAGACAAGATGGCCTCCTCCTCCTCCTCAGCCTACCCC
ATGGTCGACCACGCCATCCTATCACGGGCCGTCGACATCGAAGCCTCCATCAAAGAATGGTCCCCCCGATGGCCC
CCAGGCGACAGCCGGAACCGCGTGGCGCCGCTGTACAGGCAAGTCATGTGGGTGTACCTCTTCCGAACCATCTAC
CCTCCCTGCCGCCCATCACCGGGGACGACAGCCCCGACGCCCTCACCCCAACCTCCCGAGACCCGACGTCGAGAC
CCGCCACGCAAGCCCCGGCATCCAAGCCCCTCACCAGAAGAAGCCAAGACGGGAAGCGACGAACCCCCCCAGAAC
CCCGTGCCAACCGACGGACGCATAACCCTAGCCGTCAACGAATCCATCTCCATCCTCGAATCCTTCCGCCCTTCA
GACCCCATCCAAACCCTCCTGCTGGTCCCCTGCCTCCTCATCGGAACAGCCTGCTTCCATCCCCGACAGCGCCGC
CGCATCCGCTCATCCGTCGGCCTCGTCAGGAGCTACACCGGACTCCGCAGCTGCGATCGAGCGGCCGAGCTCCTC
GAGGCGCTTTGGTCTCTCATGGATGAGGGCCAGTGGATGGCTGTGTGGGATTGGCAGGGCGTCGCGCGGGGGATG
GGATTGGATTTCCTGTGCGCTTGA
Transcript >Ophcf2|03131
ATGTGCGAGGGCTATCACGAGAAGCAGCTGTGGAAGAGCGGAAGAGAGAGGGCAGAAGGTGACGGACGAAGGGGC
GAGTGCCTACCAACTGTGACGATGCCGCCTCTCATCCACGGCGTCGAGACGAGCGAAGATAGAATACTATGGCGA
CACTACGTCAGTCACCTCAGCAACGTCCTGACGGTCGAGGGCGAGGCCAAGAACGCCTTCAAGGACGTCATCCTG
CAGCTCGCCAACCAGCATCAGGGCCTGATGCACTCGGTGCTGGCCCTGAGCAGCAGGCACATGGACCTCAGCTCC
CCCTACGGCGTCCGCGTGCTCCAGAGCCACGCGGGCACGAGCCGCGAGTCCCTCCAGCGACGGGCCGAACACCAC
CACGCCGAGGCGCTGAAGCGGCTTTACGAAGACCTGGAGAAGTCGCTGGGCAAGGACGATCCCGAGTACCAGACG
ATGCTCGCCGGTCGATACGGTCAAATCCTCTGCCTCCTCCTCCAGACGAGGACGGACGGCAACCCGCGAGGCGAG
CACAGGCTTCACCTCCAGGCTTATCAGAGCCTGATCCAGCAGTCGCCGCCAGGAGACGCGGCCTTTTATACGTTC
GTCACCGAGTTCTTCCAGTACCACGTCTACACAGACGATCTCCTCTGGCACCCGAGCATGATGACGCGGCGGCTA
TCGACGGAAAGCTGGCAGCCGTCCACCCCGACGGAATCCCCCCGTCTCCTGGGCGTAGCAGACGGCCTCTTCAGA
CAACTCTCCCACATCAACAGCGTCCGCAACGCCATCCGAGACAAGATGGCCTCCTCCTCCTCCTCAGCCTACCCC
ATGGTCGACCACGCCATCCTATCACGGGCCGTCGACATCGAAGCCTCCATCAAAGAATGGTCCCCCCGATGGCCC
CCAGGCGACAGCCGGAACCGCGTGGCGCCGCTGTACAGGCAAGTCATGTGGGTGTACCTCTTCCGAACCATCTAC
CCTCCCTGCCGCCCATCACCGGGGACGACAGCCCCGACGCCCTCACCCCAACCTCCCGAGACCCGACGTCGAGAC
CCGCCACGCAAGCCCCGGCATCCAAGCCCCTCACCAGAAGAAGCCAAGACGGGAAGCGACGAACCCCCCCAGAAC
CCCGTGCCAACCGACGGACGCATAACCCTAGCCGTCAACGAATCCATCTCCATCCTCGAATCCTTCCGCCCTTCA
GACCCCATCCAAACCCTCCTGCTGGTCCCCTGCCTCCTCATCGGAACAGCCTGCTTCCATCCCCGACAGCGCCGC
CGCATCCGCTCATCCGTCGGCCTCGTCAGGAGCTACACCGGACTCCGCAGCTGCGATCGAGCGGCCGAGCTCCTC
GAGGCGCTTTGGTCTCTCATGGATGAGGGCCAGTGGATGGCTGTGTGGGATTGGCAGGGCGTCGCGCGGGGGATG
GGATTGGATTTCCTGTGCGCTTGA
Gene >Ophcf2|03131
ATGTGCGAGGGCTATCACGAGAAGCAGCTGTGGAAGAGCGGAAGAGAGAGGGCAGAAGGTGGTGAGTTCGATGAC
ATGATGTGTGTGATGGAAAAGACTGACGGTCGATCATCTTCTGCAAGACGGACGAAGGGGCGAGTGCCTACCAAC
TGTGACGATGCCGCCTCTCATCCACGGCGTCGAGACGAGCGAAGATAGAATACTATGGCGACACTACGTCAGTCA
CCTCAGCAACGTCCTGACGGTCGAGGGCGAGGCCAAGAACGCCTTCAAGGACGTCATCCTGCAGCTCGCCAACCA
GCATCAGGGCCTGATGCACTCGGTGCTGGCCCTGAGCAGCAGGCACATGGACCTCAGCTCCCCCTACGGCGTCCG
CGTGCTCCAGAGCCACGCGGGCACGAGCCGCGAGTCCCTCCAGCGACGGGCCGAACACCACCACGCCGAGGCGCT
GAAGCGGCTTTACGAAGACCTGGAGAAGTCGCTGGGCAAGGACGATCCCGAGTACCAGACGATGCTCGCCGGTCG
ATACGGTCAAATCCTCTGCCTCCTCCTCCAGACGAGGACGGACGGCAACCCGCGAGGCGAGCACAGGCTTCACCT
CCAGGCTTATCAGAGCCTGATCCAGCAGTCGCCGCCAGGAGACGCGGCCTTTTATACGTTCGTCACCGAGTTCTT
CCAGTACCACGTCTACACAGACGATCTCCTCTGGCACCCGAGCATGATGACGCGGCGGCTATCGACGGAAAGCTG
GCAGCCGTCCACCCCGACGGAATCCCCCCGTCTCCTGGGCGTAGCAGACGGCCTCTTCAGACAACTCTCCCACAT
CAACAGCGTCCGCAACGCCATCCGAGACAAGATGGCCTCCTCCTCCTCCTCAGCCTACCCCATGGTCGACCACGC
CATCCTATCACGGGCCGTCGACATCGAAGCCTCCATCAAAGAATGGTCCCCCCGATGGCCCCCAGGCGACAGCCG
GAACCGCGTGGCGCCGCTGTACAGGCAAGTCATGTGGGTGTACCTCTTCCGAACCATCTACCCTCCCTGCCGCCC
ATCACCGGGGACGACAGCCCCGACGCCCTCACCCCAACCTCCCGAGACCCGACGTCGAGACCCGCCACGCAAGCC
CCGGCATCCAAGCCCCTCACCAGAAGAAGCCAAGACGGGAAGCGACGAACCCCCCCAGAACCCCGTGCCAACCGA
CGGACGCATAACCCTAGCCGTCAACGAATCCATCTCCATCCTCGAATCCTTCCGCCCTTCAGACCCCATCCAAAC
CCTCCTGCTGGTCCCCTGCCTCCTCATCGGAACAGCCTGCTTCCATCCCCGACAGCGCCGCCGCATCCGCTCATC
CGTCGGCCTCGTCAGGAGCTACACCGGACTCCGCAGCTGCGATCGAGCGGCCGAGCTCCTCGAGGCGCTTTGGTC
TCTCATGGATGAGGGCCAGTGGATGGCTGTGTGGGATTGGCAGGGCGTCGCGCGGGGGATGGGATTGGATTTCCT
GTGCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail