Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03122
Gene name
Locationscaffold_03:710274..711593
Strand+
Gene length (bp)1319
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 8.8E-25 19 304

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 41 63 22
3 83 105 22
4 110 132 22
5 137 156 19
6 161 183 22
7 198 220 22
8 232 254 22
9 259 281 22
10 333 355 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.69 0.16 3.21
Alive In ants, during behavior modification 16.24 6.49 26.00
Dead In ants, recently dead 26.22 12.17 40.27

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.021816 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03122
MDVEKQVPVGGRGLHPSLHIVNWMLWSNLTVLFNKAIIDTGFRYPILLTCWHLIFASIATQLLARYTPLLDSRHS
LAMTSRLYLPTLLPIGIFYSGSLVCSNLVYLHLSVAFTQMLKSAAPVVALFVAWAWRLQEPSVGALVNMLVMMAG
VGMASVGEVRFSLVGFLLQLAGTIFEVIRLAMIQVMLSNKGLKMEPLVGLYYYAPICAAMNVFVAIPTELPYFRR
EHLTPWLAGVLVLNALTAFMLNIASVFLIGKTSGLTMTMAGILKNMLLIVASVLIWQTRITLLQAAGYSLALAGL
VYYSAGREVLARARQVSASAAAVLAEWCLDNRVGIIVLTGCASLVMVYGLLRLYGAAAGELVLSMA*
Coding >Ophcf2|03122
ATGGACGTCGAAAAGCAAGTGCCTGTCGGTGGCAGGGGCTTGCATCCGAGTCTTCACATTGTGAACTGGATGCTG
TGGTCGAATCTGACGGTGCTCTTCAACAAGGCCATCATCGACACTGGCTTCAGATATCCTATACTGCTCACCTGC
TGGCATCTCATCTTCGCCTCCATTGCCACGCAGCTTCTGGCACGATACACGCCGCTCCTCGACTCGCGTCACTCC
CTAGCCATGACGAGTCGTCTATATCTTCCGACGCTGTTGCCCATCGGCATCTTCTACAGCGGCTCGCTCGTGTGT
TCCAACCTCGTCTACCTCCATCTGTCAGTGGCCTTTACCCAGATGCTCAAGTCGGCCGCGCCCGTCGTCGCCTTG
TTCGTAGCCTGGGCCTGGCGCCTCCAGGAGCCGTCGGTCGGGGCGCTGGTCAATATGCTCGTCATGATGGCCGGG
GTGGGTATGGCTTCCGTCGGAGAGGTACGCTTCTCTCTGGTCGGCTTCCTCTTACAGCTCGCCGGCACCATCTTC
GAGGTCATCCGTCTGGCCATGATTCAGGTCATGCTCAGCAACAAGGGGCTCAAGATGGAGCCGCTCGTCGGACTG
TATTACTATGCGCCGATTTGCGCGGCCATGAACGTCTTTGTCGCTATCCCCACCGAGCTGCCCTACTTTCGACGG
GAGCATCTGACGCCGTGGCTGGCAGGGGTGTTGGTCCTCAATGCCCTGACGGCGTTTATGCTCAATATTGCCAGC
GTCTTTCTGATTGGAAAGACGTCTGGCTTGACGATGACGATGGCGGGCATCCTGAAGAACATGCTGCTCATCGTC
GCCTCGGTCCTCATCTGGCAAACGCGCATCACGCTGCTACAGGCTGCGGGCTATAGCCTCGCCCTGGCCGGTCTG
GTCTACTACTCAGCGGGCCGCGAAGTCCTGGCACGCGCACGACAGGTCTCCGCCAGCGCGGCCGCAGTGCTAGCG
GAGTGGTGTCTTGACAACAGGGTCGGCATCATCGTCCTCACCGGCTGCGCGTCCCTAGTCATGGTCTACGGACTT
TTACGGCTGTACGGCGCGGCGGCGGGCGAGCTGGTCTTGTCAATGGCGTGA
Transcript >Ophcf2|03122
ATGGACGTCGAAAAGCAAGTGCCTGTCGGTGGCAGGGGCTTGCATCCGAGTCTTCACATTGTGAACTGGATGCTG
TGGTCGAATCTGACGGTGCTCTTCAACAAGGCCATCATCGACACTGGCTTCAGATATCCTATACTGCTCACCTGC
TGGCATCTCATCTTCGCCTCCATTGCCACGCAGCTTCTGGCACGATACACGCCGCTCCTCGACTCGCGTCACTCC
CTAGCCATGACGAGTCGTCTATATCTTCCGACGCTGTTGCCCATCGGCATCTTCTACAGCGGCTCGCTCGTGTGT
TCCAACCTCGTCTACCTCCATCTGTCAGTGGCCTTTACCCAGATGCTCAAGTCGGCCGCGCCCGTCGTCGCCTTG
TTCGTAGCCTGGGCCTGGCGCCTCCAGGAGCCGTCGGTCGGGGCGCTGGTCAATATGCTCGTCATGATGGCCGGG
GTGGGTATGGCTTCCGTCGGAGAGGTACGCTTCTCTCTGGTCGGCTTCCTCTTACAGCTCGCCGGCACCATCTTC
GAGGTCATCCGTCTGGCCATGATTCAGGTCATGCTCAGCAACAAGGGGCTCAAGATGGAGCCGCTCGTCGGACTG
TATTACTATGCGCCGATTTGCGCGGCCATGAACGTCTTTGTCGCTATCCCCACCGAGCTGCCCTACTTTCGACGG
GAGCATCTGACGCCGTGGCTGGCAGGGGTGTTGGTCCTCAATGCCCTGACGGCGTTTATGCTCAATATTGCCAGC
GTCTTTCTGATTGGAAAGACGTCTGGCTTGACGATGACGATGGCGGGCATCCTGAAGAACATGCTGCTCATCGTC
GCCTCGGTCCTCATCTGGCAAACGCGCATCACGCTGCTACAGGCTGCGGGCTATAGCCTCGCCCTGGCCGGTCTG
GTCTACTACTCAGCGGGCCGCGAAGTCCTGGCACGCGCACGACAGGTCTCCGCCAGCGCGGCCGCAGTGCTAGCG
GAGTGGTGTCTTGACAACAGGGTCGGCATCATCGTCCTCACCGGCTGCGCGTCCCTAGTCATGGTCTACGGACTT
TTACGGCTGTACGGCGCGGCGGCGGGCGAGCTGGTCTTGTCAATGGCGTGA
Gene >Ophcf2|03122
ATGGACGTCGAAAAGCAAGTGCCTGTCGGTGGCAGGGGCTTGCATCCGAGTCTTCACATTGTGTTCGTTGAGAGC
CTGGTTTCCTTGTTAGACGAGGAGGGTATTCGCTGACGGCGTAGGAACTGGATGCTGTGGTCGAATCTGACGGTG
CTCTTCAACAAGGCCATCATCGACACTGGCTTCAGTAAGTTTGCGGGAGGATTGATGGAAGCGGCTAACGTCTTC
AACAGGATATCGTCCGTCAGCTCTCTTGACTCCATGTCTATGCGATGGAGGCTGACTCTAACAGCTATACTGCTC
ACCTGCTGGCATCTCATCTTCGCCTCCATTGCCACGCAGCTTCTGGCACGATACACGCCGCTCCTCGACTCGCGT
CACTCCCTAGCCATGACGAGTCGTCTATATCTTCCGACGCTGTTGCCCATCGGCATCTTCTACAGCGGCTCGCTC
GTGTGTTCCAACCTCGTCTACCTCCATCTGTCAGTGGCCTTTACCCAGATGCTCAAGTCGGCCGCGCCCGTCGTC
GCCTTGTTCGTAGCCTGGGCCTGGCGCCTCCAGGAGCCGTCGGTCGGGGCGCTGGTCAATATGCTCGTCATGATG
GCCGGGGTGGGTATGGCTTCCGTCGGAGAGGTACGCTTCTCTCTGGTCGGCTTCCTCTTACAGCTCGCCGGCACC
ATCTTCGAGGTCATCCGTCTGGCCATGATTCAGGTCATGCTCAGCAACAAGGGGCTCAAGATGGAGCCGCTCGTC
GGACTGTATTACTATGCGCCGATTTGCGCGGCCATGAACGTCTTTGTCGCTATCCCCACCGAGCTGCCCTACTTT
CGACGGGAGCATCTGACGCCGTGGCTGGCAGGGGTGTTGGTCCTCAATGCCCTGACGGCGTTTATGCTCAATATT
GCCAGCGTCTTTCTGGTGAGTCGGATGACTTGGTTTCCACCTGTCGTGTCTCTGACGTGGGTATGTGTGCATATA
AGATTGGAAAGACGTCTGGCTTGACGATGACGATGGCGGGCATCCTGAAGAACATGCTGCTCATCGTCGCCTCGG
TCCTCATCTGGCAAACGCGCATCACGCTGCTACAGGCTGCGGGCTATAGCCTCGCCCTGGCCGGTCTGGTCTACT
ACTCAGCGGGCCGCGAAGTCCTGGCACGCGCACGACAGGTCTCCGCCAGCGCGGCCGCAGTGCTAGCGGAGTGGT
GTCTTGACAACAGGGTCGGCATCATCGTCCTCACCGGCTGCGCGTCCCTAGTCATGGTCTACGGACTTTTACGGC
TGTACGGCGCGGCGGCGGGCGAGCTGGTCTTGTCAATGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail