Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03116
Gene name
Locationscaffold_03:701676..702735
Strand+
Gene length (bp)1059
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03060 NMO Nitronate monooxygenase 2.5E-50 9 332
PF00478 IMPDH IMP dehydrogenase / GMP reductase domain 4.6E-09 6 238

GO

GO Term Description Terminal node
GO:0018580 nitronate monooxygenase activity Yes
GO:0003824 catalytic activity Yes
GO:0016703 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of one atom of oxygen (internal monooxygenases or internal mixed function oxidases) No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0004497 monooxygenase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Peroxisome Peroxisomal targeting signal 0.626 0.3841 0.0197 0.1049 0.2219 0.0621 0.0198 0.3512 0.0504 0.7995

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup125
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2776
Ophiocordyceps australis 1348a (Ghana) OphauG2|5872
Ophiocordyceps australis map64 (Brazil) OphauB2|1928
Ophiocordyceps australis map64 (Brazil) OphauB2|2687
Ophiocordyceps camponoti-floridani Ophcf2|03116 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04066
Ophiocordyceps camponoti-rufipedis Ophun1|449
Ophiocordyceps camponoti-rufipedis Ophun1|6023
Ophiocordyceps kimflemingae Ophio5|6568
Ophiocordyceps kimflemingae Ophio5|8097
Ophiocordyceps subramaniannii Hirsu2|10080
Ophiocordyceps subramaniannii Hirsu2|1120

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03116
MASQGPISTPLTRLLGIRHPILLAGMARVSGGKLAAAVSNAGGLGVIGGFQYTPDQLREIIAEMKAHLASPDLPF
GIDLALPQVGGGARKTNHDYTGGKLDELIDITIDSGARLFVSAVGVPPQYVVDRLHKHGILVMNMVGHPRHAVKA
LDRGVDLVCAQGTEGGGHTGDVTTGILVPAVADVARRYRPSLLKGETALVVAAGGICDGRGLASSLMMGATGVWV
GTRFVAAAEANCSEEHKRAVVDCEWSDTERTLVLTGRPLRTKVNGYIKMWHQRPAEIRDLCDKGVVPIEHDLDAG
VADVDFPHVMGQVAGSIREVQPAARIVAEMVAEAREMLKMGGVFLGRVEGKL*
Coding >Ophcf2|03116
ATGGCATCCCAAGGTCCCATCTCAACGCCGCTGACACGCCTCCTCGGCATCCGGCATCCCATCCTGCTGGCCGGA
ATGGCGCGCGTGTCGGGCGGGAAGCTGGCAGCGGCTGTGTCTAACGCGGGCGGTCTCGGCGTCATCGGTGGCTTC
CAGTACACGCCCGATCAGCTGCGTGAAATCATTGCCGAGATGAAGGCTCATCTGGCGTCGCCGGACCTGCCGTTT
GGTATTGACCTTGCGCTGCCGCAGGTTGGGGGAGGGGCGCGCAAGACGAATCATGATTATACGGGGGGGAAGCTG
GATGAGCTTATTGATATCACCATCGACAGCGGCGCCAGGTTGTTCGTCAGCGCCGTTGGGGTGCCGCCTCAGTAT
GTTGTCGACCGGTTGCATAAACATGGGATTCTGGTCATGAACATGGTTGGACACCCGCGACATGCCGTCAAGGCC
CTCGACCGGGGCGTCGACCTCGTCTGCGCTCAGGGAACTGAGGGGGGTGGCCACACGGGCGACGTGACGACGGGG
ATCCTCGTCCCTGCTGTGGCGGATGTTGCTCGTCGCTATCGTCCGAGTCTTCTGAAGGGGGAGACGGCGCTCGTG
GTGGCGGCGGGCGGAATCTGCGATGGTCGTGGGCTGGCGAGCTCGCTGATGATGGGCGCTACGGGTGTTTGGGTC
GGAACGCGCTTCGTCGCCGCGGCCGAGGCGAACTGCAGCGAGGAACACAAGCGCGCCGTCGTCGACTGCGAATGG
TCCGATACGGAGCGAACTCTGGTCCTCACGGGGCGACCTCTACGGACAAAGGTCAACGGCTATATCAAGATGTGG
CATCAACGCCCGGCCGAGATACGGGACCTCTGCGATAAGGGCGTCGTGCCTATAGAGCACGACCTCGATGCCGGC
GTTGCGGACGTTGACTTTCCGCACGTGATGGGGCAGGTTGCTGGTTCGATTCGTGAGGTTCAGCCTGCGGCGCGG
ATTGTGGCTGAGATGGTGGCTGAGGCGCGTGAGATGCTGAAGATGGGAGGGGTGTTTTTGGGGAGGGTGGAGGGG
AAGCTGTAG
Transcript >Ophcf2|03116
ATGGCATCCCAAGGTCCCATCTCAACGCCGCTGACACGCCTCCTCGGCATCCGGCATCCCATCCTGCTGGCCGGA
ATGGCGCGCGTGTCGGGCGGGAAGCTGGCAGCGGCTGTGTCTAACGCGGGCGGTCTCGGCGTCATCGGTGGCTTC
CAGTACACGCCCGATCAGCTGCGTGAAATCATTGCCGAGATGAAGGCTCATCTGGCGTCGCCGGACCTGCCGTTT
GGTATTGACCTTGCGCTGCCGCAGGTTGGGGGAGGGGCGCGCAAGACGAATCATGATTATACGGGGGGGAAGCTG
GATGAGCTTATTGATATCACCATCGACAGCGGCGCCAGGTTGTTCGTCAGCGCCGTTGGGGTGCCGCCTCAGTAT
GTTGTCGACCGGTTGCATAAACATGGGATTCTGGTCATGAACATGGTTGGACACCCGCGACATGCCGTCAAGGCC
CTCGACCGGGGCGTCGACCTCGTCTGCGCTCAGGGAACTGAGGGGGGTGGCCACACGGGCGACGTGACGACGGGG
ATCCTCGTCCCTGCTGTGGCGGATGTTGCTCGTCGCTATCGTCCGAGTCTTCTGAAGGGGGAGACGGCGCTCGTG
GTGGCGGCGGGCGGAATCTGCGATGGTCGTGGGCTGGCGAGCTCGCTGATGATGGGCGCTACGGGTGTTTGGGTC
GGAACGCGCTTCGTCGCCGCGGCCGAGGCGAACTGCAGCGAGGAACACAAGCGCGCCGTCGTCGACTGCGAATGG
TCCGATACGGAGCGAACTCTGGTCCTCACGGGGCGACCTCTACGGACAAAGGTCAACGGCTATATCAAGATGTGG
CATCAACGCCCGGCCGAGATACGGGACCTCTGCGATAAGGGCGTCGTGCCTATAGAGCACGACCTCGATGCCGGC
GTTGCGGACGTTGACTTTCCGCACGTGATGGGGCAGGTTGCTGGTTCGATTCGTGAGGTTCAGCCTGCGGCGCGG
ATTGTGGCTGAGATGGTGGCTGAGGCGCGTGAGATGCTGAAGATGGGAGGGGTGTTTTTGGGGAGGGTGGAGGGG
AAGCTGTAG
Gene >Ophcf2|03116
ATGGCATCCCAAGGTCCCATCTCAACGCCGCTGACACGCCTCCTCGGCATCCGGCATCCCATCCTGCTGGCCGGA
ATGGCGCGCGTGTCGGGCGGGAAGCTGGCAGCGGCTGTGTCTAACGCGGGCGGTCTCGGCGTCATCGGTGGCTTC
CAGTACACGCCCGATCAGCTGCGTGAAATCATTGCCGAGATGAAGGCTCATCTGGCGTCGCCGGACCTGCCGTTT
GGTATTGACCTTGCGCTGCCGCAGGTTGGGGGAGGGGCGCGCAAGACGAATCATGATTATACGGGGGGGAAGCTG
GATGAGCTTATTGATATCACCATCGACAGCGGCGCCAGGTTGTTCGTCAGCGCCGTTGGGGTGCCGCCTCAGTAT
GTTGTCGACCGGTTGCATAAACATGGGATTCTGGTCATGAACATGGTTGGACACCCGCGACATGCCGTCAAGGCC
CTCGACCGGGGCGTCGACCTCGTCTGCGCTCAGGGAACTGAGGGGGGTGGCCACACGGGCGACGTGACGACGGGG
ATCCTCGTCCCTGCTGTGGCGGATGTTGCTCGTCGCTATCGTCCGAGTCTTCTGAAGGGGGAGACGGCGCTCGTG
GTGGCGGCGGGCGGAATCTGCGATGGTCGTGGGCTGGCGAGCTCGCTGATGATGGGCGCTACGGGTGTTTGGGTC
GGAACGCGCTTCGTCGCCGCGGCCGAGGCGAACTGCAGCGAGGAACACAAGCGCGCCGTCGTCGACTGCGAATGG
TCCGATACGGAGCGAACTCTGGTCCTCACGGGGCGACCTCTACGGACAAAGGTCAACGGCTATATCAAGATGTGG
CATCAACGCCCGGCCGAGATACGGGACCTCTGCGATAAGGGCGTCGTGCCTATAGAGCACGACCTCGATGCCGGC
GTTGCGGACGTTGACTTTCCGCACGTGATGGGGCAGGTTGCTGGTTCGATTCGTGAGGTTCAGCCTGCGGCGCGG
ATTGTGGCTGAGATGGTGGCTGAGGCGCGTGAGATGCTGAAGATGGGAGGGGTGTTTTTGGGGAGGGTGGAGGGG
AAGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail