Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03112
Gene name
Locationscaffold_03:688523..689411
Strand-
Gene length (bp)888
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06148 COG2 COG (conserved oligomeric Golgi) complex component, COG2 2.0E-24 36 164

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus|Lysosome/Vacuole Nuclear export signal 0.5003 0.5688 0.2189 0.0728 0.0375 0.0125 0.1054 0.7752 0.5283 0.1333

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1777
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7043
Ophiocordyceps australis map64 (Brazil) OphauB2|1935
Ophiocordyceps camponoti-floridani Ophcf2|03112 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4749
Ophiocordyceps kimflemingae Ophio5|8101
Ophiocordyceps subramaniannii Hirsu2|1701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03112
MAPARGSSPNSSSDSSDPSPSVADDTPLPFPAALPRSDFLAADFQPAAYLSALPHRHQTLEDLRADLRDRSSAIS
AELLELVNANYTSFLSLGSELQGGDDRVQGLRVALLGFRRAVDEIKANVSRRRGEMSALNAQLRLARLSIARGRA
MLDLSDRIAALEESLAVAPDGQDGAEVSADVDGTDDDEDDESDHTDADQNLRGLLGGPPARLLQCARECRRLHAL
ATSLDPQNPFLVKLQGRLSKCRSTLLLDLSTALKEARGTGHKADGRVMQYLQIYRVLETSRDAVKALRAH*
Coding >Ophcf2|03112
ATGGCTCCCGCTCGGGGGTCCTCACCGAACTCTTCCTCCGACTCCTCTGATCCCTCACCATCCGTAGCAGATGAC
ACGCCGCTTCCGTTCCCTGCCGCTCTACCGCGCTCCGACTTTCTAGCCGCCGACTTCCAGCCAGCCGCCTACCTC
TCAGCGCTGCCTCACCGCCACCAGACGCTCGAGGACCTGCGAGCCGACCTACGCGACCGCAGCAGCGCCATCAGC
GCCGAACTTCTCGAGCTCGTCAACGCAAACTACACCTCTTTTCTGTCTCTCGGTAGTGAGCTTCAGGGCGGCGAC
GACCGGGTTCAAGGTCTGCGAGTCGCTCTCCTCGGCTTCCGCCGCGCCGTGGACGAGATCAAGGCCAATGTTTCT
CGACGGCGTGGCGAGATGTCCGCTCTTAACGCGCAATTACGGCTTGCGCGTTTATCCATCGCCCGGGGGCGCGCC
ATGCTTGACCTCTCGGATCGCATTGCTGCGCTGGAGGAGAGTCTCGCTGTCGCGCCTGATGGCCAAGACGGGGCT
GAAGTGTCTGCTGATGTCGATGGTACCGATGATGACGAGGATGACGAGTCAGACCACACCGATGCCGACCAAAAT
CTACGAGGCCTTCTCGGCGGTCCGCCAGCCAGGCTGCTGCAATGTGCGAGGGAATGTCGCCGTCTTCATGCGCTG
GCGACCTCACTCGATCCTCAAAATCCCTTTCTCGTCAAGTTGCAGGGCCGTCTTTCCAAATGTCGGAGCACTTTG
CTGCTCGACTTGTCCACCGCGCTCAAGGAGGCAAGGGGCACCGGACACAAGGCGGACGGCAGGGTCATGCAGTAT
TTACAGATATACCGCGTTCTGGAAACATCGCGAGACGCCGTCAAGGCGCTCCGCGCCCATTGA
Transcript >Ophcf2|03112
ATGGCTCCCGCTCGGGGGTCCTCACCGAACTCTTCCTCCGACTCCTCTGATCCCTCACCATCCGTAGCAGATGAC
ACGCCGCTTCCGTTCCCTGCCGCTCTACCGCGCTCCGACTTTCTAGCCGCCGACTTCCAGCCAGCCGCCTACCTC
TCAGCGCTGCCTCACCGCCACCAGACGCTCGAGGACCTGCGAGCCGACCTACGCGACCGCAGCAGCGCCATCAGC
GCCGAACTTCTCGAGCTCGTCAACGCAAACTACACCTCTTTTCTGTCTCTCGGTAGTGAGCTTCAGGGCGGCGAC
GACCGGGTTCAAGGTCTGCGAGTCGCTCTCCTCGGCTTCCGCCGCGCCGTGGACGAGATCAAGGCCAATGTTTCT
CGACGGCGTGGCGAGATGTCCGCTCTTAACGCGCAATTACGGCTTGCGCGTTTATCCATCGCCCGGGGGCGCGCC
ATGCTTGACCTCTCGGATCGCATTGCTGCGCTGGAGGAGAGTCTCGCTGTCGCGCCTGATGGCCAAGACGGGGCT
GAAGTGTCTGCTGATGTCGATGGTACCGATGATGACGAGGATGACGAGTCAGACCACACCGATGCCGACCAAAAT
CTACGAGGCCTTCTCGGCGGTCCGCCAGCCAGGCTGCTGCAATGTGCGAGGGAATGTCGCCGTCTTCATGCGCTG
GCGACCTCACTCGATCCTCAAAATCCCTTTCTCGTCAAGTTGCAGGGCCGTCTTTCCAAATGTCGGAGCACTTTG
CTGCTCGACTTGTCCACCGCGCTCAAGGAGGCAAGGGGCACCGGACACAAGGCGGACGGCAGGGTCATGCAGTAT
TTACAGATATACCGCGTTCTGGAAACATCGCGAGACGCCGTCAAGGCGCTCCGCGCCCATTGA
Gene >Ophcf2|03112
ATGGCTCCCGCTCGGGGGTCCTCACCGAACTCTTCCTCCGACTCCTCTGATCCCTCACCATCCGTAGCAGATGAC
ACGCCGCTTCCGTTCCCTGCCGCTCTACCGCGCTCCGACTTTCTAGCCGCCGACTTCCAGCCAGCCGCCTACCTC
TCAGCGCTGCCTCACCGCCACCAGACGCTCGAGGACCTGCGAGCCGACCTACGCGACCGCAGCAGCGCCATCAGC
GCCGAACTTCTCGAGCTCGTCAACGCAAACTACACCTCTTTTCTGTCTCTCGGTAGTGAGCTTCAGGGCGGCGAC
GACCGGGTTCAAGGTCTGCGAGTCGCTCTCCTCGGCTTCCGCCGCGCCGTGGACGAGATCAAGGCCAATGTTTCT
CGACGGCGTGGCGAGATGTCCGCTCTTAACGCGCAATTACGGCTTGCGCGTTTATCCATCGCCCGGGGGCGCGCC
ATGCTTGACCTCTCGGATCGCATTGCTGCGCTGGAGGAGAGTCTCGCTGTCGCGCCTGATGGCCAAGACGGGGCT
GAAGTGTCTGCTGATGTCGATGGTACCGATGATGACGAGGATGACGAGTCAGACCACACCGATGCCGACCAAAAT
CTACGAGGCCTTCTCGGCGGTCCGCCAGCCAGGCTGCTGCAATGTGCGAGGGAATGTCGCCGTCTTCATGCGCTG
GCGACCTCACTCGATCCTCAAAATCCCTTTCTCGTCAAGTTGCAGGGCCGTCTTTCCAAATGTCGGAGCACTTTG
CTGCTCGACTTGTCCACCGCGCTCAAGGAGGCAAGGGGCACCGGACACAAGGCGGACGGCAGGGTCATGCAGTAT
TTACAGATATACCGCGTTCTGGAAACATCGCGAGACGCCGTCAAGGCGCTCCGCGCCCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail