Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03111
Gene name
Locationscaffold_03:687333..688324
Strand+
Gene length (bp)991
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 5.7E-23 104 287

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1352 0.1856 0.0543 0.0589 0.9111 0.0907 0.0308 0.0276 0.0363 0.005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4931
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7001
Ophiocordyceps australis map64 (Brazil) OphauB2|1934
Ophiocordyceps camponoti-floridani Ophcf2|03111 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4750
Ophiocordyceps kimflemingae Ophio5|8102
Ophiocordyceps subramaniannii Hirsu2|1700

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03111
MARLSLSCVARPLATRLPRYLTPTHVKAEAYGTAKIKVDKKKKGEKRSKDPREKAAEELKAAKLNEPTLFIRHKL
EKYDFPQFSLCDAMRVIRAAEVGQPPTTIKYELHIMLSGHRRGPAVRGTIRLPAPAQNDWQIAVICPEGSQEAMQ
ATAEGAVLVGEEKIFEAVRKQDFTFDRLLCHESSENSLKRANLGRILGPKGLMPSDKTGTIITDVVKIMRASAGS
IAFREREGVVHSTVGQLSNTVEQLQSNIRALVKSVRLQCVKVSDNTIQKEISEVVLSSTNGPAFTLNGNVADENA
TITPEQVSGPM*
Coding >Ophcf2|03111
ATGGCCAGGCTCAGTCTGTCATGCGTCGCGCGACCTTTGGCGACAAGACTGCCACGATACCTCACTCCCACTCAT
GTCAAGGCCGAGGCGTACGGGACCGCCAAGATCAAGGTCGACAAGAAGAAAAAAGGGGAAAAGAGAAGCAAGGAT
CCTCGAGAAAAGGCTGCCGAAGAGCTAAAGGCGGCGAAACTCAACGAGCCAACACTCTTTATTCGACACAAGCTG
GAAAAGTACGACTTTCCCCAGTTTTCGCTCTGCGATGCCATGAGGGTCATACGGGCGGCAGAAGTCGGCCAGCCT
CCGACTACCATCAAGTACGAGTTGCACATCATGCTCAGCGGACACCGCCGCGGTCCGGCCGTCAGGGGGACCATC
CGGCTCCCGGCCCCGGCGCAGAACGACTGGCAGATCGCCGTAATCTGCCCCGAAGGTAGCCAAGAGGCCATGCAG
GCTACGGCCGAGGGAGCCGTTCTCGTCGGCGAGGAAAAGATCTTCGAGGCCGTCCGGAAGCAAGATTTTACTTTT
GACCGACTTCTCTGCCATGAATCGAGCGAGAACAGCCTCAAGAGAGCCAACCTGGGCAGGATCCTCGGCCCAAAG
GGTCTAATGCCCAGCGATAAAACGGGTACCATCATCACCGATGTGGTCAAGATCATGAGAGCCTCTGCCGGCTCC
ATTGCATTTCGCGAGCGTGAAGGCGTCGTCCACTCCACGGTCGGGCAGTTGTCCAATACGGTGGAGCAGCTCCAG
TCCAACATTCGGGCCCTAGTGAAAAGTGTGAGGCTACAATGTGTTAAAGTATCCGACAACACGATACAAAAGGAG
ATAAGTGAGGTTGTCCTGAGCTCGACCAATGGGCCCGCGTTTACACTGAACGGTAACGTGGCAGATGAGAACGCT
ACGATCACGCCGGAGCAGGTGTCCGGCCCCATGTAG
Transcript >Ophcf2|03111
ATGGCCAGGCTCAGTCTGTCATGCGTCGCGCGACCTTTGGCGACAAGACTGCCACGATACCTCACTCCCACTCAT
GTCAAGGCCGAGGCGTACGGGACCGCCAAGATCAAGGTCGACAAGAAGAAAAAAGGGGAAAAGAGAAGCAAGGAT
CCTCGAGAAAAGGCTGCCGAAGAGCTAAAGGCGGCGAAACTCAACGAGCCAACACTCTTTATTCGACACAAGCTG
GAAAAGTACGACTTTCCCCAGTTTTCGCTCTGCGATGCCATGAGGGTCATACGGGCGGCAGAAGTCGGCCAGCCT
CCGACTACCATCAAGTACGAGTTGCACATCATGCTCAGCGGACACCGCCGCGGTCCGGCCGTCAGGGGGACCATC
CGGCTCCCGGCCCCGGCGCAGAACGACTGGCAGATCGCCGTAATCTGCCCCGAAGGTAGCCAAGAGGCCATGCAG
GCTACGGCCGAGGGAGCCGTTCTCGTCGGCGAGGAAAAGATCTTCGAGGCCGTCCGGAAGCAAGATTTTACTTTT
GACCGACTTCTCTGCCATGAATCGAGCGAGAACAGCCTCAAGAGAGCCAACCTGGGCAGGATCCTCGGCCCAAAG
GGTCTAATGCCCAGCGATAAAACGGGTACCATCATCACCGATGTGGTCAAGATCATGAGAGCCTCTGCCGGCTCC
ATTGCATTTCGCGAGCGTGAAGGCGTCGTCCACTCCACGGTCGGGCAGTTGTCCAATACGGTGGAGCAGCTCCAG
TCCAACATTCGGGCCCTAGTGAAAAGTGTGAGGCTACAATGTGTTAAAGTATCCGACAACACGATACAAAAGGAG
ATAAGTGAGGTTGTCCTGAGCTCGACCAATGGGCCCGCGTTTACACTGAACGGTAACGTGGCAGATGAGAACGCT
ACGATCACGCCGGAGCAGGTGTCCGGCCCCATGTAG
Gene >Ophcf2|03111
ATGGCCAGGCTCAGTCTGTCATGCGTCGCGCGACCTTTGGCGACAAGACTGCCACGATACCTCACTCCCACTCAT
GTCAAGGCCGAGGCGTACGGGACCGCCAAGATCAAGGTCGACAAGAAGAAAAAAGGGGAAAAGAGAAGCAAGGAT
CCTCGAGAAAAGGCTGCCGAAGAGCTAAAGGCGGCGAAACTCAACGAGCCAACACTCTTTATTCGACACAAGCTG
GAAAAGTACGACTTTCCCCAGTTTTCGCTCTGCGATGCCATGAGGTAGGTATGCTCGCTAGCCTTCGCAGACGGC
GTGATACTAAGAATGTCGCGGCAGGGTCATACGGGCGGCAGAAGTCGGCCAGCCTCCGACTACCATCAAGTACGA
GTTGCACATCATGCTCAGCGGACACCGCCGCGGTCCGGCCGTCAGGGGGACCATCCGGCTCCCGGCCCCGGCGCA
GAACGACTGGCAGATCGCCGTAATCTGCCCCGAAGGTAGCCAAGAGGCCATGCAGGCTACGGCCGAGGGAGCCGT
TCTCGTCGGCGAGGAAAAGATCTTCGAGGCCGTCCGGAAGCAAGATTTTACTTTTGACCGACTTCTCTGCCATGA
ATCGAGCGAGAACAGCCTCAAGAGAGCCAACCTGGGCAGGATCCTCGGCCCAAAGGGTCTAATGCCCAGCGATAA
AACGGGTACCATCATCACCGATGTGGTCAAGATCATGAGAGCCTCTGCCGGCTCCATTGCATTTCGCGAGCGTGA
AGGCGTCGTCCACTCCACGGTCGGGCAGTTGTCCAATACGGTGGAGCAGCTCCAGTCCAACATTCGGGCCCTAGT
GAAAAGTGTGAGGCTACAATGTGTTAAAGTATCCGACAACACGATACAAAAGGAGATAAGTGAGGTTGTCCTGAG
CTCGACCAATGGGCCCGCGTTTACACTGAACGGTAACGTGGCAGATGAGAACGCTACGATCACGCCGGAGCAGGT
GTCCGGCCCCATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail