Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03106
Gene name
Locationscaffold_03:671046..673513
Strand+
Gene length (bp)2467
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04120 Iron_permease Low affinity iron permease 1.7E-11 182 267
PF04120 Iron_permease Low affinity iron permease 4.6E-19 399 468

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 92 114 22
3 192 211 19
4 221 243 22
5 295 317 22
6 332 351 19
7 407 429 22
8 444 461 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03106
MKRKAFTMKRLLALLSSYGAKGPIEHAAPTQHVKDENTASSNVTGYADRDKERALDRWLDRVVKASGSEPVFLFI
VAGLVVWAFLGIKYGHTADWAVLISDIQAIVSYVFDSLLMRQQLNEYEKMVRVSASLRSRAISNRRMLRALLNDP
RRTRQQHGSAADQQLQRLTPSCETLPPETLVDRLSTAASRVVGHLVAVCLYWVCIAVWLGFGPFCDWSNGWQLAI
NSATSALMVFIFAFLANVQERHAAHVERCLNAIFEHDSAVERVLRAMTGDDLGNETVVVVAPRMSRIQRAILYYA
DLVGTLTGIAILTVVMIVWLAIGPVMGFSSNWWLLIGTYAGLVGLNDSFVLRNVQMLFHGYAQEALDQVDLEDKS
ILDQLRLPDPAATAIPIPSEPLTYRISAWMGVICAHEATVIVGFVFILGLLAGASAMRWSTAGQLLCNIPPSIIE
TFFMMILITGHNQAETKRHDRLERFFMRRSVLLSYCESRQLQLEKWYSLSLENN*
Coding >Ophcf2|03106
ATGAAGCGCAAAGCCTTCACAATGAAGCGCCTCCTGGCACTGCTCTCATCGTACGGAGCAAAAGGGCCGATAGAG
CACGCTGCTCCGACACAACATGTCAAGGACGAGAATACGGCATCTTCTAATGTGACGGGCTACGCTGATAGGGAT
AAGGAGCGCGCGCTGGATCGTTGGCTCGATCGCGTCGTCAAGGCTTCTGGCTCGGAACCCGTTTTCCTCTTCATC
GTCGCTGGCCTCGTCGTCTGGGCCTTTCTCGGCATCAAGTACGGTCATACGGCTGACTGGGCCGTTCTCATATCC
GATATCCAAGCCATCGTCAGCTACGTCTTCGACTCGCTACTCATGCGCCAGCAGCTCAACGAGTATGAGAAGATG
GTCCGCGTATCGGCCAGTCTGCGGTCCCGAGCTATTAGCAACAGGAGGATGCTACGCGCCTTGCTCAACGACCCG
CGCCGTACGCGGCAGCAGCATGGTTCAGCAGCCGATCAGCAGCTACAACGGCTGACACCCTCGTGCGAGACGCTG
CCTCCAGAGACGCTCGTTGACCGACTGTCTACAGCCGCGTCCCGAGTCGTCGGTCACCTGGTTGCCGTTTGTCTG
TACTGGGTCTGCATCGCCGTCTGGCTGGGCTTCGGTCCCTTTTGCGACTGGAGTAACGGGTGGCAGCTGGCCATC
AACTCGGCTACGTCTGCGCTCATGGTCTTTATCTTTGCCTTTCTGGCCAACGTTCAGGAACGACATGCGGCTCAC
GTTGAGCGTTGTCTGAATGCCATCTTTGAGCATGACTCGGCTGTTGAACGGGTCTTGAGGGCTATGACGGGCGAT
GACTTGGGCAATGAGACGGTCGTTGTTGTCGCGCCCCGGATGAGCAGGATTCAGAGGGCCATTCTCTACTACGCT
GATCTCGTCGGGACTCTTACCGGAATCGCAATCCTGACGGTTGTCATGATCGTCTGGCTGGCTATCGGGCCCGTC
ATGGGCTTCAGTTCTAACTGGTGGCTCCTTATCGGCACCTACGCTGGTCTCGTCGGCCTCAACGACAGCTTCGTC
CTTCGAAACGTCCAGATGCTCTTCCACGGCTACGCACAGGAAGCACTGGACCAAGTCGACCTCGAAGACAAGTCC
ATCCTCGATCAACTCCGACTCCCAGATCCAGCCGCCACCGCCATCCCTATCCCTTCCGAGCCACTCACCTACCGC
ATCTCAGCGTGGATGGGCGTCATCTGCGCGCATGAAGCGACCGTCATCGTCGGCTTTGTCTTTATCCTCGGTTTG
CTGGCTGGTGCTTCGGCTATGAGGTGGTCTACTGCTGGCCAGCTGCTTTGTAACATCCCGCCCAGCATCATCGAG
ACGTTTTTCATGATGATTCTCATTACGGGGCATAATCAGGCGGAGACGAAGAGACATGATCGTTTGGAGAGGTTC
TTTATGAGGCGCTCGGTGCTGCTTTCGTATTGCGAGTCTAGACAACTTCAACTCGAAAAGTGGTATTCTCTTTCT
TTGGAGAATAATTGA
Transcript >Ophcf2|03106
ATGAAGCGCAAAGCCTTCACAATGAAGCGCCTCCTGGCACTGCTCTCATCGTACGGAGCAAAAGGGCCGATAGAG
CACGCTGCTCCGACACAACATGTCAAGGACGAGAATACGGCATCTTCTAATGTGACGGGCTACGCTGATAGGGAT
AAGGAGCGCGCGCTGGATCGTTGGCTCGATCGCGTCGTCAAGGCTTCTGGCTCGGAACCCGTTTTCCTCTTCATC
GTCGCTGGCCTCGTCGTCTGGGCCTTTCTCGGCATCAAGTACGGTCATACGGCTGACTGGGCCGTTCTCATATCC
GATATCCAAGCCATCGTCAGCTACGTCTTCGACTCGCTACTCATGCGCCAGCAGCTCAACGAGTATGAGAAGATG
GTCCGCGTATCGGCCAGTCTGCGGTCCCGAGCTATTAGCAACAGGAGGATGCTACGCGCCTTGCTCAACGACCCG
CGCCGTACGCGGCAGCAGCATGGTTCAGCAGCCGATCAGCAGCTACAACGGCTGACACCCTCGTGCGAGACGCTG
CCTCCAGAGACGCTCGTTGACCGACTGTCTACAGCCGCGTCCCGAGTCGTCGGTCACCTGGTTGCCGTTTGTCTG
TACTGGGTCTGCATCGCCGTCTGGCTGGGCTTCGGTCCCTTTTGCGACTGGAGTAACGGGTGGCAGCTGGCCATC
AACTCGGCTACGTCTGCGCTCATGGTCTTTATCTTTGCCTTTCTGGCCAACGTTCAGGAACGACATGCGGCTCAC
GTTGAGCGTTGTCTGAATGCCATCTTTGAGCATGACTCGGCTGTTGAACGGGTCTTGAGGGCTATGACGGGCGAT
GACTTGGGCAATGAGACGGTCGTTGTTGTCGCGCCCCGGATGAGCAGGATTCAGAGGGCCATTCTCTACTACGCT
GATCTCGTCGGGACTCTTACCGGAATCGCAATCCTGACGGTTGTCATGATCGTCTGGCTGGCTATCGGGCCCGTC
ATGGGCTTCAGTTCTAACTGGTGGCTCCTTATCGGCACCTACGCTGGTCTCGTCGGCCTCAACGACAGCTTCGTC
CTTCGAAACGTCCAGATGCTCTTCCACGGCTACGCACAGGAAGCACTGGACCAAGTCGACCTCGAAGACAAGTCC
ATCCTCGATCAACTCCGACTCCCAGATCCAGCCGCCACCGCCATCCCTATCCCTTCCGAGCCACTCACCTACCGC
ATCTCAGCGTGGATGGGCGTCATCTGCGCGCATGAAGCGACCGTCATCGTCGGCTTTGTCTTTATCCTCGGTTTG
CTGGCTGGTGCTTCGGCTATGAGGTGGTCTACTGCTGGCCAGCTGCTTTGTAACATCCCGCCCAGCATCATCGAG
ACGTTTTTCATGATGATTCTCATTACGGGGCATAATCAGGCGGAGACGAAGAGACATGATCGTTTGGAGAGGTTC
TTTATGAGGCGCTCGGTGCTGCTTTCGTATTGCGAGTCTAGACAACTTCAACTCGAAAAGTGGTATTCTCTTTCT
TTGGAGAATAATTGA
Gene >Ophcf2|03106
ATGAAGCGCAAAGCCTTCACAATGAAGCGCCTCCTGGCACTGCTCTCATCGTACGGAGCAAAAGGGCCGATAGAG
CACGCTGCTCCGACACAACATGTCAAGGACGAGAATACGGCATCTTCTAATGTGACGGGCTACGCTGATAGGGAT
AAGGAGCGCGCGCTGGATCGTTGGCTCGATCGCGTCGTCAAGGCTTCTGGCTCGGAACCCGTTTTCCTCTTCATC
GTCGCTGGCCTCGTCGTCTGGGCCTTTCTCGGCATCAAGTACGGTCATACGGCTGACTGGGCCGTTCTCATATCC
GATATCCAAGCCATCGTCAGCTACGTCTTCGACTCGCTACTCATGCGCCAGCAGCTCAACGAGTATGAGAAGATG
GTCCGCGTATCGGCCAGTCTGCGGTCCCGAGCTATTAGCAACAGGAGGATGCTACGCGCCTTGCTCAACGACCCG
CGCCGTACGCGGCAGCAGCATGGTTCAGCAGCCGATCAGCAGCTACAACGGCTGACACCCTCGTGCGAGACGCTG
CCTCCAGAGACGCTCGTTGACCGACTGTCTACAGCCGCGTCCCGAGTCGTCGGTCACCTGGTTGCCGTTTGTCTG
TACTGGGTCTGCATCGCCGTCTGGCTGGGCTTCGGTCCCTTTTGCGACTGGAGTAACGGGTGGCAGCTGGCCATC
AACTCGGCTACGTCTGCGCTCATGGTCTTTATCTTTGCCTTTCTGGCCAACGTTCAGGAACGACATGCGGCTCAC
GTTGAGCGTTGTCTGAATGCCATCTTTGAGCATGACTCGGCTGTTGAACGGGTCTTGAGGGCTATGACGGGCGAT
GACTTGGGCAATGAGACGGTCGTTGTTGTCGCGCCCCGGATGAGCAGGATTCAGAGGGCCATTCTCTACTACGCT
GATCTCGTCGGGACTCTTACCGGAATCGCAATCCTGACGGTTGTCATGATCGTCTGGCTGGCTATCGGGCCCGTC
ATGGGCTTCAGTTCTAACTGGTGGCTCCTTATCGGCACCTACGCTGGTCTCGTCGGCCTCAACGACAGCTTCGTC
CTTCGAAACGTCCAGATGCTCTTCCACGGCTACGCACAGGAAGCACTGGACCAAGTCGACCTCGAAGACAAGTCC
ATCCTCGATCAACTCCGACTCCCAGATCCAGCCGCCACCGCCATCCCTATCCCTTCCGAGCCACTCACCTACCGC
ATCTCAGCGTGGATGGGCGTCATCTGCGCGCATGAAGCGACCGTCATCGTCGGCTTTGTCTTTATCCTCGGTTTG
CTGGCTGGTGCTTCGGCTATGAGGTGGTCTACTGCTGGCCAGCTGCTTTGTAACATCCCGCCCAGCATCATCGAG
ACGTTTTTCATGATGATTCTCATTACGGGGCATAATCAGGCGGAGACGAAGAGACATGATCGTTTGGAGAGGTTC
TTTATGAGGCGCTCGGTGCTGCTTTCGTATGTGCGGGGGCTCGAGGTTGGGGATGAATCGGGGGCGGGGATGGAT
CTTTGCATGAGGTTTAGGGTGGTTTTGTTGTTTTGTGAGTTAATTCTGTGTTGCTTTGAAGGTATCAAGCGATGA
CTACATGGTCTGTGTGTTCTCGTTTCAAGGTCATGCAGAAAGCAACCCGGAGTTTGTCTCATCTTTAAGCATAAT
CGTGTTTCTTATGCCGTTCTCGGTGGAACACATCAGACTACAGTTCAGACAATTCCCAGGTTGTTTGAAAGGTTA
ACTCTAATGCAGATGAGTCTCCCCCATCGCTATAAAGGCAACTGGCGACAACTAACAAGAACCGGCTGCTTGCAA
GTTGCATCTGATGATTTACTTAGGCTACATAATGGGATGTCCAACGTCTCTGTGGCGAAGACGGGACTTGAGCTC
CAATAATGGATGAACTGAGTCAGGTATGTAGAGCTTGTGTCTTGTGGCTTGTGATGTCAGTGATAATCATGGCTA
AGAAAATTGAACAATCCTCTTTCCACGTGCTCAATCACAACTTTCCTCACATCACCTCCATTGCAACCCTACTTC
CAACCCCATCCTCAAAAATGCAGTACAAATCATCATCAAAAAGCGTCCATAGGACAAAAGACCACCCACCACTTA
CTCGTATGACACACCCAACCCGACTTCATCACCCACCCCAGCCGCCATCCGAATCTCTCAACACACGCCGATCCA
ACGTCTACCTGGAGCTGTCCCGGTCAGCCGAGCCAGCGTCTAGATATCGCGGGGCTTAACCGGCCAAAGGCGTGA
CCGGGCTCTGCGTGGTGTCGATCATCCGTCTGCCAGCGTGTTTCACGGCTGTTTTCGCGCCTTTGCCGGCGTGGC
CTCTAGCTTGCGGGAGGCTGGGCTCGATGGTTTTGCTGCTGTGACTCGAGAAGGAAAGAGAGGTTGCTGATGTCA
TTTCCAGTGCGAGTCTAGACAACTTCAACTCGAAAAGTGGTATTCTCTTTCTTTGGAGAATAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail