Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03104
Gene name
Locationscaffold_03:667025..668398
Strand+
Gene length (bp)1373
Transcript length (bp)1257
Coding sequence length (bp)1257
Protein length (aa) 419

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08059 SEP SEP domain 2.7E-24 222 295
PF00789 UBX UBX domain 1.9E-09 339 404
PF14555 UBA_4 UBA-like domain 5.3E-09 10 48

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5892 0.6578 0.0409 0.0323 0.0999 0.0155 0.1776 0.0767 0.107 0.036

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3301
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3176
Ophiocordyceps australis map64 (Brazil) OphauB2|1727
Ophiocordyceps camponoti-floridani Ophcf2|03104 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3799
Ophiocordyceps kimflemingae Ophio5|8109
Ophiocordyceps subramaniannii Hirsu2|6083

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03104
MAEQNAPDRDEMVRDFCDMCEASPEMATQYLAAHNWDYLAACNTFFTEDIDERLDEGPSQERPEEPYTGPRTVDG
RPAPQAYRRSRNNEPAAKEEGVATLASLASASQQGGGNDDDDDADDDDLDGDTEDGRGNLFAGGEKSGLAVQDPK
QEGGSRQIINDILAKARANSRPDAASEAGPSRSSLFRGTGMTLGGEGVQSRAVPDPLGPVRPANSQPLERVLHIW
QDGFSIDDGELHRYDDPANRADLQMIRSGRAPLHLMNVQHDQLVDVKLHQHDTPYSPPPKQYKPFGGAGHRLGSP
VPGGTSEAPATTAGGSTTTSTTTAATTSNPSEPAVDGSQPTVMIRIQLPDGTRLPARFNTTHTLGDVYGFIQGAS
PETRTRAWVLVTTFPNKEHKDKELVLGDIPEFKKGGTAVVKWT*
Coding >Ophcf2|03104
ATGGCCGAGCAAAACGCCCCAGACCGGGATGAGATGGTCCGCGACTTCTGCGACATGTGCGAAGCCAGCCCTGAG
ATGGCCACGCAGTATCTCGCGGCCCATAATTGGGACTATCTCGCAGCCTGCAATACCTTCTTCACCGAGGACATC
GATGAGAGGCTCGACGAGGGCCCCTCCCAAGAACGCCCGGAGGAACCGTACACTGGCCCTCGCACCGTCGATGGC
CGGCCAGCGCCTCAAGCCTACCGACGAAGCCGCAATAACGAGCCGGCGGCAAAGGAAGAAGGTGTTGCCACGCTG
GCTTCTCTCGCATCAGCATCTCAACAAGGTGGTGGTAACGATGACGATGATGACGCGGATGACGACGACCTTGAT
GGCGATACCGAGGACGGCCGCGGGAACCTCTTTGCTGGCGGCGAGAAGTCTGGTCTTGCCGTACAAGATCCCAAG
CAGGAAGGCGGATCGCGTCAAATTATCAACGATATTCTGGCCAAAGCCAGAGCCAATTCGCGCCCAGACGCAGCC
TCTGAAGCTGGCCCCTCACGATCTTCACTCTTCCGAGGCACAGGCATGACGTTGGGCGGCGAGGGCGTTCAGAGC
CGTGCCGTGCCTGATCCGCTCGGTCCAGTCCGACCCGCCAACTCGCAGCCGCTGGAGCGCGTGCTGCATATCTGG
CAGGACGGATTCAGCATCGATGACGGCGAGTTGCATCGCTACGATGATCCTGCCAACCGAGCAGACCTGCAGATG
ATACGTTCGGGTCGTGCGCCATTGCACTTGATGAATGTGCAGCACGACCAGCTCGTCGATGTGAAGCTGCACCAA
CACGATACCCCATACTCGCCGCCTCCCAAGCAGTATAAACCCTTTGGGGGAGCCGGACATCGGCTGGGCAGCCCT
GTACCGGGTGGCACTTCGGAAGCTCCCGCCACGACGGCCGGCGGATCAACGACGACGAGCACGACGACAGCCGCC
ACTACCTCGAACCCTTCTGAGCCGGCTGTCGACGGCTCGCAGCCTACCGTCATGATCCGGATCCAGCTGCCAGAT
GGCACTCGGCTGCCGGCACGCTTCAACACGACCCATACGCTCGGCGACGTCTACGGTTTCATCCAGGGCGCTTCC
CCGGAGACGCGCACCCGGGCGTGGGTTCTCGTCACAACCTTTCCCAACAAGGAGCACAAAGACAAGGAACTGGTA
CTGGGTGACATTCCCGAGTTCAAGAAGGGAGGTACGGCTGTCGTCAAGTGGACATAG
Transcript >Ophcf2|03104
ATGGCCGAGCAAAACGCCCCAGACCGGGATGAGATGGTCCGCGACTTCTGCGACATGTGCGAAGCCAGCCCTGAG
ATGGCCACGCAGTATCTCGCGGCCCATAATTGGGACTATCTCGCAGCCTGCAATACCTTCTTCACCGAGGACATC
GATGAGAGGCTCGACGAGGGCCCCTCCCAAGAACGCCCGGAGGAACCGTACACTGGCCCTCGCACCGTCGATGGC
CGGCCAGCGCCTCAAGCCTACCGACGAAGCCGCAATAACGAGCCGGCGGCAAAGGAAGAAGGTGTTGCCACGCTG
GCTTCTCTCGCATCAGCATCTCAACAAGGTGGTGGTAACGATGACGATGATGACGCGGATGACGACGACCTTGAT
GGCGATACCGAGGACGGCCGCGGGAACCTCTTTGCTGGCGGCGAGAAGTCTGGTCTTGCCGTACAAGATCCCAAG
CAGGAAGGCGGATCGCGTCAAATTATCAACGATATTCTGGCCAAAGCCAGAGCCAATTCGCGCCCAGACGCAGCC
TCTGAAGCTGGCCCCTCACGATCTTCACTCTTCCGAGGCACAGGCATGACGTTGGGCGGCGAGGGCGTTCAGAGC
CGTGCCGTGCCTGATCCGCTCGGTCCAGTCCGACCCGCCAACTCGCAGCCGCTGGAGCGCGTGCTGCATATCTGG
CAGGACGGATTCAGCATCGATGACGGCGAGTTGCATCGCTACGATGATCCTGCCAACCGAGCAGACCTGCAGATG
ATACGTTCGGGTCGTGCGCCATTGCACTTGATGAATGTGCAGCACGACCAGCTCGTCGATGTGAAGCTGCACCAA
CACGATACCCCATACTCGCCGCCTCCCAAGCAGTATAAACCCTTTGGGGGAGCCGGACATCGGCTGGGCAGCCCT
GTACCGGGTGGCACTTCGGAAGCTCCCGCCACGACGGCCGGCGGATCAACGACGACGAGCACGACGACAGCCGCC
ACTACCTCGAACCCTTCTGAGCCGGCTGTCGACGGCTCGCAGCCTACCGTCATGATCCGGATCCAGCTGCCAGAT
GGCACTCGGCTGCCGGCACGCTTCAACACGACCCATACGCTCGGCGACGTCTACGGTTTCATCCAGGGCGCTTCC
CCGGAGACGCGCACCCGGGCGTGGGTTCTCGTCACAACCTTTCCCAACAAGGAGCACAAAGACAAGGAACTGGTA
CTGGGTGACATTCCCGAGTTCAAGAAGGGAGGTACGGCTGTCGTCAAGTGGACATAG
Gene >Ophcf2|03104
ATGGCCGAGCAAAACGCCCCAGACCGGGATGAGATGGTCCGCGACTTCTGCGACATGTGCGAAGCCAGCCCTGAG
ATGGTACAGCCAGCCTCTCTCTACCACACAAATTTCCGAAGCAGGCGCTGACGCAACTTTCGCAGGCCACGCAGT
ATCTCGCGGCCCATAATTGGGACTATCTCGCAGCCTGCAATACCTTCTTCACCGAGGACATCGATGAGAGGCTCG
ACGAGGGCCCCTCCCAAGAACGCCCGGAGGAACCGTACACTGGCCCTCGCACCGTCGATGGCCGGCCAGCGCCTC
AAGCCTACCGACGAAGCCGCAATAACGAGCCGGCGGCAAAGGAAGAAGGTGTTGCCACGCTGGCTTCTCTCGCAT
CAGCATCTCAACAAGGTGGTGGTAACGATGACGATGATGACGCGGATGACGACGACCTTGATGGCGATACCGAGG
ACGGCCGCGGGAACCTCTTTGCTGGCGGCGAGAAGTCTGGTCTTGCCGTACAAGATCCCAAGCAGGAAGGCGGAT
CGCGTCAAATTATCAACGATATTCTGGCCAAAGCCAGAGCGTGCGTATCTGTTCGTGACGCCTTCGAGGCCGTAC
GCTGACGTTGAGTCCGCAGCAATTCGCGCCCAGACGCAGCCTCTGAAGCTGGCCCCTCACGATCTTCACTCTTCC
GAGGCACAGGCATGACGTTGGGCGGCGAGGGCGTTCAGAGCCGTGCCGTGCCTGATCCGCTCGGTCCAGTCCGAC
CCGCCAACTCGCAGCCGCTGGAGCGCGTGCTGCATATCTGGCAGGACGGATTCAGCATCGATGACGGCGAGTTGC
ATCGCTACGATGATCCTGCCAACCGAGCAGACCTGCAGATGATACGTTCGGGTCGTGCGCCATTGCACTTGATGA
ATGTGCAGCACGACCAGCTCGTCGATGTGAAGCTGCACCAACACGATACCCCATACTCGCCGCCTCCCAAGCAGT
ATAAACCCTTTGGGGGAGCCGGACATCGGCTGGGCAGCCCTGTACCGGGTGGCACTTCGGAAGCTCCCGCCACGA
CGGCCGGCGGATCAACGACGACGAGCACGACGACAGCCGCCACTACCTCGAACCCTTCTGAGCCGGCTGTCGACG
GCTCGCAGCCTACCGTCATGATCCGGATCCAGCTGCCAGATGGCACTCGGCTGCCGGCACGCTTCAACACGACCC
ATACGCTCGGCGACGTCTACGGTTTCATCCAGGGCGCTTCCCCGGAGACGCGCACCCGGGCGTGGGTTCTCGTCA
CAACCTTTCCCAACAAGGAGCACAAAGACAAGGAACTGGTACTGGGTGACATTCCCGAGTTCAAGAAGGGAGGTA
CGGCTGTCGTCAAGTGGACATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail