Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03096
Gene name
Locationscaffold_03:642195..644106
Strand-
Gene length (bp)1911
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-18 72 491
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.1E-07 119 511

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 102 121 19
3 133 152 19
4 157 179 22
5 192 214 22
6 224 246 22
7 277 299 22
8 304 326 22
9 345 367 22
10 382 404 22
11 413 432 19
12 447 469 22
13 476 498 22
14 552 571 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 306.26 146.80 465.71
Alive In ants, during behavior modification 87.35 42.76 131.93
Dead In ants, recently dead 76.71 41.76 111.67

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.528951 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03096
MGTKTTRRLFGRAAEESPRSKEADAKTDSPLADETGPDGDAVSPDAQTGVQKAEAMTKAWTTRSLIVAYILIWLI
YFVDSLQQGVTTALHPFITSAFQQHSLTAATGIMSNLMGGLLKLPLAKILDIWGRPQGFALTTVLLTLGLVMMAA
CNTVETYAAAQVFYWVGFNGMGYSLSVFIADTSALENRGLMLAFLYSPFIITAWTGGPIATSVMPGIGWRWFFGI
FAIITLAVSLPLIALFAYNLVKAKRLGLMPARDGPRRGLLQATRHFLIEFDVIGLLLITGGLALFLLPFSIYTYQ
PARWRSPLIICMLVFGVLLLVCFALYEKLVAPVQFLPYRLLVDRTILGAMVSATMTFIAFFLWDSYLLSLLQVVN
DLSLTDATYIIKIFTVGSCFSGLIVGLLIRWSGRFKWLALYFGLPLTILGVGLMMHFGQPHSPIGYVIMCQIFIA
LAGGAITICEQTAVLAVISHQHAAVVLAVLSMCSSVGGAIGSTLSAAIWTTVLPRKLEELLPAEAQSNRTTIYND
LVAQLSYPRGSPVREAISEAYSETQKIMIISAIVALFVALAAVFAWRDVRVKDSKQTKGTVV*
Coding >Ophcf2|03096
ATGGGCACCAAGACAACCCGTCGTCTCTTCGGCCGCGCCGCAGAAGAATCCCCGCGGTCCAAAGAAGCCGACGCA
AAGACCGACAGCCCCTTGGCCGACGAGACCGGCCCCGATGGCGACGCCGTCTCTCCCGACGCCCAGACCGGCGTC
CAGAAGGCAGAGGCCATGACCAAGGCGTGGACGACAAGATCGCTGATTGTGGCATACATCTTAATCTGGCTCATC
TACTTTGTCGACTCGCTGCAGCAGGGCGTCACCACGGCTCTTCATCCCTTCATCACCAGCGCCTTCCAACAACAT
TCGCTCACGGCGGCGACGGGAATCATGTCCAATCTCATGGGCGGCCTGTTGAAGCTGCCGCTGGCAAAGATTCTC
GACATCTGGGGCCGCCCTCAGGGTTTCGCCCTCACCACGGTGCTGCTGACGCTCGGCCTCGTCATGATGGCAGCA
TGCAACACGGTCGAGACCTACGCCGCTGCCCAAGTCTTTTACTGGGTCGGTTTTAACGGAATGGGCTACAGCCTC
TCCGTCTTCATCGCCGACACGTCGGCGCTCGAGAACCGCGGCCTCATGTTGGCTTTCCTCTACTCGCCCTTCATC
ATCACCGCCTGGACCGGCGGCCCCATCGCGACCAGTGTTATGCCCGGCATCGGCTGGCGCTGGTTCTTTGGCATC
TTCGCCATCATCACCCTCGCCGTCTCCCTGCCCCTAATCGCCCTCTTCGCCTACAACCTCGTCAAGGCCAAGAGA
TTGGGCCTGATGCCCGCTCGCGACGGGCCCCGACGCGGCCTGCTACAGGCCACGCGCCATTTCCTGATCGAGTTC
GATGTCATCGGCCTGCTGCTCATCACTGGCGGTCTCGCCCTCTTTCTGCTGCCCTTTAGCATCTATACGTATCAG
CCAGCCAGGTGGCGATCTCCCCTAATCATCTGCATGCTCGTCTTCGGCGTCTTGCTGCTCGTCTGCTTCGCTCTG
TACGAGAAGCTCGTTGCGCCCGTCCAATTCCTCCCGTACCGGCTGCTGGTAGACCGCACCATCCTCGGCGCCATG
GTGTCGGCCACGATGACATTCATCGCCTTTTTCCTCTGGGATAGTTACCTGCTATCGCTTCTGCAGGTTGTGAAC
GACTTGTCGCTGACGGACGCGACGTACATCATCAAGATCTTCACCGTCGGCAGCTGTTTCTCCGGTCTCATCGTC
GGCCTCCTGATCCGATGGTCGGGCCGTTTCAAGTGGCTGGCTCTCTACTTTGGCCTGCCGCTCACCATCCTAGGC
GTCGGCCTCATGATGCACTTCGGCCAGCCTCACAGCCCCATCGGCTACGTCATCATGTGCCAGATCTTCATCGCC
CTGGCCGGGGGAGCCATCACCATCTGCGAGCAAACAGCCGTCTTGGCCGTCATCTCCCACCAGCACGCCGCCGTC
GTCCTGGCCGTCCTATCCATGTGCTCGTCAGTCGGGGGCGCCATCGGCAGCACGCTATCAGCCGCCATCTGGACC
ACCGTCCTTCCCCGCAAGCTGGAAGAGCTGCTCCCGGCCGAGGCCCAGTCCAACCGGACGACCATCTACAACGAC
CTGGTAGCTCAGCTATCGTACCCCAGGGGATCACCCGTGCGCGAGGCCATCAGCGAGGCCTACAGCGAGACGCAG
AAGATCATGATCATCTCCGCCATCGTCGCCTTGTTCGTGGCGCTGGCGGCCGTCTTTGCCTGGCGGGACGTTCGC
GTCAAGGACTCCAAGCAGACCAAGGGGACGGTCGTATAG
Transcript >Ophcf2|03096
ATGGGCACCAAGACAACCCGTCGTCTCTTCGGCCGCGCCGCAGAAGAATCCCCGCGGTCCAAAGAAGCCGACGCA
AAGACCGACAGCCCCTTGGCCGACGAGACCGGCCCCGATGGCGACGCCGTCTCTCCCGACGCCCAGACCGGCGTC
CAGAAGGCAGAGGCCATGACCAAGGCGTGGACGACAAGATCGCTGATTGTGGCATACATCTTAATCTGGCTCATC
TACTTTGTCGACTCGCTGCAGCAGGGCGTCACCACGGCTCTTCATCCCTTCATCACCAGCGCCTTCCAACAACAT
TCGCTCACGGCGGCGACGGGAATCATGTCCAATCTCATGGGCGGCCTGTTGAAGCTGCCGCTGGCAAAGATTCTC
GACATCTGGGGCCGCCCTCAGGGTTTCGCCCTCACCACGGTGCTGCTGACGCTCGGCCTCGTCATGATGGCAGCA
TGCAACACGGTCGAGACCTACGCCGCTGCCCAAGTCTTTTACTGGGTCGGTTTTAACGGAATGGGCTACAGCCTC
TCCGTCTTCATCGCCGACACGTCGGCGCTCGAGAACCGCGGCCTCATGTTGGCTTTCCTCTACTCGCCCTTCATC
ATCACCGCCTGGACCGGCGGCCCCATCGCGACCAGTGTTATGCCCGGCATCGGCTGGCGCTGGTTCTTTGGCATC
TTCGCCATCATCACCCTCGCCGTCTCCCTGCCCCTAATCGCCCTCTTCGCCTACAACCTCGTCAAGGCCAAGAGA
TTGGGCCTGATGCCCGCTCGCGACGGGCCCCGACGCGGCCTGCTACAGGCCACGCGCCATTTCCTGATCGAGTTC
GATGTCATCGGCCTGCTGCTCATCACTGGCGGTCTCGCCCTCTTTCTGCTGCCCTTTAGCATCTATACGTATCAG
CCAGCCAGGTGGCGATCTCCCCTAATCATCTGCATGCTCGTCTTCGGCGTCTTGCTGCTCGTCTGCTTCGCTCTG
TACGAGAAGCTCGTTGCGCCCGTCCAATTCCTCCCGTACCGGCTGCTGGTAGACCGCACCATCCTCGGCGCCATG
GTGTCGGCCACGATGACATTCATCGCCTTTTTCCTCTGGGATAGTTACCTGCTATCGCTTCTGCAGGTTGTGAAC
GACTTGTCGCTGACGGACGCGACGTACATCATCAAGATCTTCACCGTCGGCAGCTGTTTCTCCGGTCTCATCGTC
GGCCTCCTGATCCGATGGTCGGGCCGTTTCAAGTGGCTGGCTCTCTACTTTGGCCTGCCGCTCACCATCCTAGGC
GTCGGCCTCATGATGCACTTCGGCCAGCCTCACAGCCCCATCGGCTACGTCATCATGTGCCAGATCTTCATCGCC
CTGGCCGGGGGAGCCATCACCATCTGCGAGCAAACAGCCGTCTTGGCCGTCATCTCCCACCAGCACGCCGCCGTC
GTCCTGGCCGTCCTATCCATGTGCTCGTCAGTCGGGGGCGCCATCGGCAGCACGCTATCAGCCGCCATCTGGACC
ACCGTCCTTCCCCGCAAGCTGGAAGAGCTGCTCCCGGCCGAGGCCCAGTCCAACCGGACGACCATCTACAACGAC
CTGGTAGCTCAGCTATCGTACCCCAGGGGATCACCCGTGCGCGAGGCCATCAGCGAGGCCTACAGCGAGACGCAG
AAGATCATGATCATCTCCGCCATCGTCGCCTTGTTCGTGGCGCTGGCGGCCGTCTTTGCCTGGCGGGACGTTCGC
GTCAAGGACTCCAAGCAGACCAAGGGGACGGTCGTATAG
Gene >Ophcf2|03096
ATGGGCACCAAGACAACCCGTCGTCTCTTCGGCCGCGCCGCAGAAGAATCCCCGCGGTCCAAAGAAGCCGACGCA
AAGACCGACAGCCCCTTGGCCGACGAGACCGGCCCCGATGGCGACGCCGTCTCTCCCGACGCCCAGACCGGCGTC
CAGAAGGCAGAGGCCATGACCAAGGCGTGGACGACAAGATCGCTGATTGTGGCATACATCTTGTGCGAATCGTCG
ACATTCCTCTCAGGTAGAAAACTGACCGTCTTTCAGAATCTGGCTCATCTACTTTGTCGACTCGCTGCAGCAGGG
CGTCACCACGGCTCTTCATCCCTTCATCACCAGCGCCTTCCAACAACATTCGCTCACGGCGGCGACGGGAATCAT
GTCCAATCTCATGGGCGGCCTGTTGAAGCTGCCGCTGGCAAAGATTCTCGACATCTGGGGCCGCCCTCAGGGTTT
CGCCCTCACCACGGTGCTGCTGACGCTCGGCCTCGTCATGATGGCAGCATGCAACACGGTCGAGACCTACGCCGC
TGCCCAAGTCTTTTACTGGGTCGGGTGAGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGT
CATCTCCTCAACAGCCAACGACGAAACGACTGACTTTTGCATGGCAGTTTTAACGGAATGGGCTACAGCCTCTCC
GTCTTCATCGCCGACACGTCGGCGCTCGAGAACCGCGGCCTCATGTTGGCTTTCCTCTACTCGCCCTTCATCATC
ACCGCCTGGACCGGCGGCCCCATCGCGACCAGTGTTATGCCCGGCATCGGCTGGCGCTGGTTCTTTGGCATCTTC
GCCATCATCACCCTCGCCGTCTCCCTGCCCCTAATCGCCCTCTTCGCCTACAACCTCGTCAAGGCCAAGAGATTG
GGCCTGATGCCCGCTCGCGACGGGCCCCGACGCGGCCTGCTACAGGCCACGCGCCATTTCCTGATCGAGTTCGAT
GTCATCGGCCTGCTGCTCATCACTGGCGGTCTCGCCCTCTTTCTGCTGCCCTTTAGCATCTATACGTATCAGCCA
GCCAGGTGGCGATCTCCCCTAATCATCTGCATGCTCGTCTTCGGCGTCTTGCTGCTCGTCTGCTTCGCTCTGTAC
GAGAAGCTCGTTGCGCCCGTCCAATTCCTCCCGTACCGGCTGCTGGTAGACCGCACCATCCTCGGCGCCATGGTG
TCGGCCACGATGACATTCATCGCCTTTTTCCTCTGGGATAGTTACCTGCTATCGCTTCTGCAGGTTGTGAACGAC
TTGTCGCTGACGGACGCGACGTACATCATCAAGATCTTCACCGTCGGCAGCTGTTTCTCCGGTCTCATCGTCGGC
CTCCTGATCCGATGGTCGGGCCGTTTCAAGTGGCTGGCTCTCTACTTTGGCCTGCCGCTCACCATCCTAGGCGTC
GGCCTCATGATGCACTTCGGCCAGCCTCACAGCCCCATCGGCTACGTCATCATGTGCCAGATCTTCATCGCCCTG
GCCGGGGGAGCCATCACCATCTGCGAGCAAACAGCCGTCTTGGCCGTCATCTCCCACCAGCACGCCGCCGTCGTC
CTGGCCGTCCTATCCATGTGCTCGTCAGTCGGGGGCGCCATCGGCAGCACGCTATCAGCCGCCATCTGGACCACC
GTCCTTCCCCGCAAGCTGGAAGAGCTGCTCCCGGCCGAGGCCCAGTCCAACCGGACGACCATCTACAACGACCTG
GTAGCTCAGCTATCGTACCCCAGGGGATCACCCGTGCGCGAGGCCATCAGCGAGGCCTACAGCGAGACGCAGAAG
ATCATGATCATCTCCGCCATCGTCGCCTTGTTCGTGGCGCTGGCGGCCGTCTTTGCCTGGCGGGACGTTCGCGTC
AAGGACTCCAAGCAGACCAAGGGGACGGTCGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail