Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03095
Gene name
Locationscaffold_03:640260..641786
Strand+
Gene length (bp)1526
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09810 Exo5 Exonuclease V - a 5' deoxyribonuclease 9.5E-128 95 456

GO

GO Term Description Terminal node
GO:0045145 single-stranded DNA 5'-3' exodeoxyribonuclease activity Yes
GO:0004536 deoxyribonuclease activity No
GO:0004529 exodeoxyribonuclease activity No
GO:0008409 5'-3' exonuclease activity No
GO:0140097 catalytic activity, acting on DNA No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0004518 nuclease activity No
GO:0004527 exonuclease activity No
GO:0035312 5'-3' exodeoxyribonuclease activity No
GO:0016796 exonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0016895 exodeoxyribonuclease activity, producing 5'-phosphomonoesters No
GO:0008297 single-stranded DNA exodeoxyribonuclease activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.4747 0.6466 0.0273 0.0121 0.3416 0.1086 0.0874 0.0619 0.0549 0.0194

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4620
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7643
Ophiocordyceps australis map64 (Brazil) OphauB2|6794
Ophiocordyceps camponoti-floridani Ophcf2|03095 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2032
Ophiocordyceps kimflemingae Ophio5|1548
Ophiocordyceps subramaniannii Hirsu2|9699

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03095
MSGSDSNLDDQYGYDFSREEELQLIRLVERASGELLPVTEDDSAVVVGRWQSSRSGRWSKGDDVDDVGYSDLRRA
LSELSGTSLPKAIQKDSSSSPLQRFRSFPRKPLSVSDLTSGSWCELQYWYTLTRLPHGRRTQTPAMKQGTAVHQT
LEEEVHVRVKVDASSKEDRFALRLWNVVQGLRTLRETGLTRELEVWGLVDGEVVNGVIDGVGVENPDLAFEEELC
EGVGGDGGDGGGDGVGVSKRIPAKKAALTDYFPPSKHGSKGRIYLTDVKTRGTTSPVSTAQLRSAKIQLLLYHRF
LSAMASDALDFSVVAARYDLDVHAVLSDAFLAQMAGLHRDIFYDAHSRPTSPDQPPTDRVPYRTLHEICSLVRAE
LRQSFPLGSASMGPLLRVQYVHRSDGRALDAHVFPFSARALDDYLAGYMAWWRGERPARGVKVDEAFKCRSCEFV
HDCEWRVRLDGARVEGAKRRLRVKGGILEVL*
Coding >Ophcf2|03095
ATGTCCGGCTCCGACTCGAATCTCGACGACCAGTACGGCTACGACTTTTCGCGCGAGGAGGAGTTGCAGCTGATA
CGGCTGGTTGAGCGAGCGAGTGGCGAGCTGCTGCCCGTGACGGAAGATGACAGCGCTGTTGTCGTTGGTCGATGG
CAGTCGAGTCGTTCGGGGCGGTGGTCGAAGGGGGATGATGTTGACGACGTCGGTTACTCTGATTTGAGGAGGGCG
TTGTCGGAGCTCAGCGGGACGTCGCTTCCCAAGGCGATACAGAAGGATTCCTCATCTTCACCTCTACAGCGCTTC
CGTTCATTCCCGCGAAAGCCCCTCTCCGTCAGCGACCTCACGTCGGGTTCCTGGTGCGAACTCCAATACTGGTAC
ACCTTGACGCGGCTGCCCCACGGCCGACGCACCCAAACGCCGGCCATGAAGCAAGGAACGGCCGTGCACCAAACG
CTGGAGGAAGAGGTCCACGTTCGGGTCAAGGTCGACGCCTCGAGCAAGGAAGACAGGTTCGCGCTCAGGCTTTGG
AATGTGGTGCAGGGCTTGCGCACCTTGCGAGAGACGGGGCTTACTCGCGAGCTCGAGGTTTGGGGCTTGGTTGAT
GGGGAGGTGGTTAACGGGGTTATTGATGGCGTGGGGGTTGAGAATCCGGATTTGGCGTTTGAGGAGGAGCTTTGT
GAGGGGGTTGGTGGTGATGGTGGTGATGGTGGTGGTGATGGTGTTGGTGTTTCCAAGAGGATTCCCGCCAAGAAG
GCGGCTTTGACGGATTATTTCCCGCCTAGCAAGCATGGCAGCAAGGGGAGAATCTATCTAACCGACGTCAAAACC
AGGGGAACAACCTCTCCCGTCTCAACCGCTCAACTCCGATCCGCAAAGATTCAACTCCTCCTCTACCACCGCTTC
CTCTCCGCCATGGCCTCCGACGCACTCGACTTCTCCGTCGTCGCCGCCCGTTACGATCTAGACGTCCACGCCGTG
CTTTCAGACGCCTTCCTCGCGCAGATGGCAGGTCTGCATCGAGACATCTTCTACGACGCCCACTCGAGACCAACC
TCGCCAGACCAACCGCCAACCGACCGAGTCCCCTACCGAACCCTCCACGAAATCTGCTCCCTCGTCCGCGCCGAG
CTACGGCAATCCTTCCCGCTGGGATCCGCCTCGATGGGGCCCCTCCTCCGCGTGCAGTACGTCCACCGCTCCGAC
GGCCGGGCTCTGGACGCCCACGTCTTTCCCTTTTCTGCCCGCGCGCTGGACGACTATCTGGCTGGGTACATGGCT
TGGTGGCGGGGGGAGAGACCGGCTAGGGGGGTCAAGGTGGACGAGGCTTTCAAGTGTCGGTCTTGTGAGTTCGTG
CACGATTGTGAGTGGAGGGTTAGGCTGGATGGGGCGAGGGTTGAGGGGGCGAAGAGGAGGTTGAGGGTCAAGGGG
GGGATTCTTGAGGTTTTGTGA
Transcript >Ophcf2|03095
ATGTCCGGCTCCGACTCGAATCTCGACGACCAGTACGGCTACGACTTTTCGCGCGAGGAGGAGTTGCAGCTGATA
CGGCTGGTTGAGCGAGCGAGTGGCGAGCTGCTGCCCGTGACGGAAGATGACAGCGCTGTTGTCGTTGGTCGATGG
CAGTCGAGTCGTTCGGGGCGGTGGTCGAAGGGGGATGATGTTGACGACGTCGGTTACTCTGATTTGAGGAGGGCG
TTGTCGGAGCTCAGCGGGACGTCGCTTCCCAAGGCGATACAGAAGGATTCCTCATCTTCACCTCTACAGCGCTTC
CGTTCATTCCCGCGAAAGCCCCTCTCCGTCAGCGACCTCACGTCGGGTTCCTGGTGCGAACTCCAATACTGGTAC
ACCTTGACGCGGCTGCCCCACGGCCGACGCACCCAAACGCCGGCCATGAAGCAAGGAACGGCCGTGCACCAAACG
CTGGAGGAAGAGGTCCACGTTCGGGTCAAGGTCGACGCCTCGAGCAAGGAAGACAGGTTCGCGCTCAGGCTTTGG
AATGTGGTGCAGGGCTTGCGCACCTTGCGAGAGACGGGGCTTACTCGCGAGCTCGAGGTTTGGGGCTTGGTTGAT
GGGGAGGTGGTTAACGGGGTTATTGATGGCGTGGGGGTTGAGAATCCGGATTTGGCGTTTGAGGAGGAGCTTTGT
GAGGGGGTTGGTGGTGATGGTGGTGATGGTGGTGGTGATGGTGTTGGTGTTTCCAAGAGGATTCCCGCCAAGAAG
GCGGCTTTGACGGATTATTTCCCGCCTAGCAAGCATGGCAGCAAGGGGAGAATCTATCTAACCGACGTCAAAACC
AGGGGAACAACCTCTCCCGTCTCAACCGCTCAACTCCGATCCGCAAAGATTCAACTCCTCCTCTACCACCGCTTC
CTCTCCGCCATGGCCTCCGACGCACTCGACTTCTCCGTCGTCGCCGCCCGTTACGATCTAGACGTCCACGCCGTG
CTTTCAGACGCCTTCCTCGCGCAGATGGCAGGTCTGCATCGAGACATCTTCTACGACGCCCACTCGAGACCAACC
TCGCCAGACCAACCGCCAACCGACCGAGTCCCCTACCGAACCCTCCACGAAATCTGCTCCCTCGTCCGCGCCGAG
CTACGGCAATCCTTCCCGCTGGGATCCGCCTCGATGGGGCCCCTCCTCCGCGTGCAGTACGTCCACCGCTCCGAC
GGCCGGGCTCTGGACGCCCACGTCTTTCCCTTTTCTGCCCGCGCGCTGGACGACTATCTGGCTGGGTACATGGCT
TGGTGGCGGGGGGAGAGACCGGCTAGGGGGGTCAAGGTGGACGAGGCTTTCAAGTGTCGGTCTTGTGAGTTCGTG
CACGATTGTGAGTGGAGGGTTAGGCTGGATGGGGCGAGGGTTGAGGGGGCGAAGAGGAGGTTGAGGGTCAAGGGG
GGGATTCTTGAGGTTTTGTGA
Gene >Ophcf2|03095
ATGTCCGGCTCCGACTCGAATCTCGACGACCAGTACGGCTACGACTTTTCGCGCGAGGAGGAGTTGCAGCTGATA
CGGCTGGTTGAGCGAGCGAGTGGCGAGCTGCTGCCCGTGACGGAAGATGACAGCGCTGTTGTCGTTGGTCGATGG
CAGTCGAGTCGTTCGGGGCGGTGGTCGAAGGGGGATGATGTTGACGACGTCGGTTACTCTGATTGTGCGGCATTT
CCCCCTTTGTTTTTCTCTCCCCCCCCCGAGCACTTGTTGATGGTGTGGACTGACGGGACAAGATGGTAGTGAGGA
GGGCGTTGTCGGAGCTCAGCGGGACGTCGCTTCCCAAGGCGATACAGAAGGATTCCTCATCTTCACCTCTACAGC
GCTTCCGTTCATTCCCGCGAAAGCCCCTCTCCGTCAGCGACCTCACGTCGGGTTCCTGGTGCGAACTCCAATACT
GGTACACCTTGACGCGGCTGCCCCACGGCCGACGCACCCAAACGCCGGCCATGAAGCAAGGAACGGCCGTGCACC
AAACGCTGGAGGAAGAGGTCCACGTTCGGGTCAAGGTCGACGCCTCGAGCAAGGAAGACAGGTTCGCGCTCAGGC
TTTGGAATGTGGTGCAGGGCTTGCGCACCTTGCGAGAGACGGGGCTTACTCGCGAGCTCGAGGTTTGGGGCTTGG
TTGATGGGGAGGTGGTTAACGGGGTTATTGATGGCGTGGGGGTTGAGAATCCGGATTTGGCGTTTGAGGAGGAGC
TTTGTGAGGGGGTTGGTGGTGATGGTGGTGATGGTGGTGGTGATGGTGTTGGTGTTTCCAAGAGGATTCCCGCCA
AGAAGGCGGCTTTGACGGATTATTTCCCGCCTAGCAAGCATGGCAGCAAGGGGAGAATCTATCTAACCGACGTCA
AAACCAGGGGAACAACCTCTCCCGTCTCAACCGCTCAACTCCGATCCGCAAAGATTCAACTCCTCCTCTACCACC
GCTTCCTCTCCGCCATGGCCTCCGACGCACTCGACTTCTCCGTCGTCGCCGCCCGTTACGATCTAGACGTCCACG
CCGTGCTTTCAGACGCCTTCCTCGCGCAGATGGCAGGTCTGCATCGAGACATCTTCTACGACGCCCACTCGAGAC
CAACCTCGCCAGACCAACCGCCAACCGACCGAGTCCCCTACCGAACCCTCCACGAAATCTGCTCCCTCGTCCGCG
CCGAGCTACGGCAATCCTTCCCGCTGGGATCCGCCTCGATGGGGCCCCTCCTCCGCGTGCAGTACGTCCACCGCT
CCGACGGCCGGGCTCTGGACGCCCACGTCTTTCCCTTTTCTGCCCGCGCGCTGGACGACTATCTGGCTGGGTACA
TGGCTTGGTGGCGGGGGGAGAGACCGGCTAGGGGGGTCAAGGTGGACGAGGCTTTCAAGTGTCGGTCTTGTGAGT
TCGTGCACGATTGTGAGTGGAGGGTTAGGCTGGATGGGGCGAGGGTTGAGGGGGCGAAGAGGAGGTTGAGGGTCA
AGGGGGGGATTCTTGAGGTTTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail