Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03093
Gene name
Locationscaffold_03:635764..638150
Strand+
Gene length (bp)2386
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 1.0E-05 58 93
PF00018 SH3_1 SH3 domain 2.1E-06 158 204
PF00787 PX PX domain 3.2E-07 335 418
PF07653 SH3_2 Variant SH3 domain 6.5E-05 34 95

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0005515 protein binding Yes
GO:0005543 phospholipid binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5855 0.2935 0.1534 0.451 0.0755 0.0015 0.203 0.4474 0.1854 0.0045

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4622
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7645
Ophiocordyceps australis map64 (Brazil) OphauB2|6796
Ophiocordyceps camponoti-floridani Ophcf2|03093 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2034
Ophiocordyceps kimflemingae Ophio5|1546
Ophiocordyceps subramaniannii Hirsu2|9701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03093
MKALRRSIKGEKHKQTPSIGSKSAVAIVPPKKVIRATDDYIPDESLMQTFAKAGVQVLSFSKGDFFHVIGREDDP
HWYEACNPALPDARGLVPVTYFQVLGRTERDSADGSRHPPMAKNPDHDSGYGETAIQQTAAPPQHSYNKSTRTAG
TVYAKVRHPFTAHPTRPDELSAEKDENLIIIAQSNHEWVVAKPIMRLGGPGLIPIDFIYVFDEAGVPSVEEWKRM
AAQYKNSSITLGKFDGGRSPGAQQPSLEQGMGRLSLQPDTRQSSGNGSHHAGEYRSAGPSPVSQEAYDAQSAPHL
SAPISAPIWARIPRYCFAEQKYWFVIETELENGRCYELSRYYQDFYDFQIALLAEFPVEAGNTGTQKRTLPYMPG
PVSYVTDAITEGRLYNLDAYVKNLLNQPPHISRCDLVKLFFAPREGDYEIDSQLNGDEEYRLSEGSHQSSADSRT
NTTSRRSSPSNADGYGYAGVAATPRVGNGTLQNSSQAAMKIKVRFNGEVFAMRVPKDVQFQDLHDKIRDRVKAVP
GEQIQLFYHDDMSGVLQILQSDLHLVHALQRQEKLTLLVKVH*
Coding >Ophcf2|03093
ATGAAGGCACTTCGCCGGTCTATAAAGGGCGAAAAGCACAAGCAAACCCCTTCCATAGGCTCCAAATCCGCCGTC
GCCATCGTCCCGCCGAAAAAGGTTATACGAGCCACCGACGACTATATCCCCGATGAGTCTCTGATGCAGACCTTT
GCCAAGGCCGGCGTCCAGGTTCTAAGCTTCTCCAAAGGCGACTTCTTCCACGTCATCGGTCGCGAGGATGATCCG
CACTGGTACGAAGCCTGCAATCCCGCCCTCCCCGACGCCCGCGGCCTCGTGCCCGTCACCTACTTTCAGGTCCTG
GGCCGCACCGAACGCGACAGCGCCGACGGCAGCAGGCATCCCCCCATGGCCAAGAACCCGGATCACGACTCGGGT
TACGGCGAGACGGCGATACAGCAAACTGCCGCACCCCCTCAACACAGCTACAACAAATCCACCAGGACGGCGGGT
ACGGTTTACGCCAAGGTTCGCCACCCCTTCACCGCCCATCCGACCCGCCCGGACGAACTTTCGGCGGAAAAGGAC
GAGAACCTCATCATCATCGCCCAATCCAACCACGAATGGGTCGTTGCGAAACCCATAATGCGACTGGGAGGCCCC
GGCCTGATCCCGATAGACTTCATCTACGTCTTCGACGAAGCTGGCGTGCCGAGCGTCGAAGAATGGAAGCGCATG
GCTGCCCAGTACAAGAACAGCAGCATCACGCTCGGAAAGTTTGATGGTGGCAGGTCTCCTGGTGCTCAACAGCCC
TCCCTCGAGCAGGGCATGGGTCGCCTGAGTCTGCAGCCGGACACGCGGCAGAGTAGCGGAAACGGGTCTCATCAC
GCTGGCGAGTATCGGAGTGCGGGCCCGTCGCCCGTTTCTCAGGAAGCCTACGATGCCCAATCGGCTCCTCATCTG
TCGGCGCCCATATCCGCGCCCATCTGGGCGAGGATACCGCGGTACTGTTTCGCCGAGCAAAAGTACTGGTTCGTC
ATCGAGACGGAGCTCGAAAACGGTCGGTGCTACGAGCTGTCGAGGTACTACCAAGACTTTTACGACTTTCAGATT
GCCCTCCTAGCCGAGTTCCCCGTCGAGGCCGGCAACACGGGCACGCAGAAGCGGACGTTGCCCTACATGCCAGGG
CCGGTCAGTTACGTCACGGATGCCATCACCGAGGGCCGGCTTTACAACCTGGACGCCTACGTCAAGAATCTGCTG
AACCAACCGCCGCATATCTCTCGCTGCGATCTGGTCAAGCTCTTCTTCGCCCCTCGAGAGGGTGACTACGAGATC
GATTCCCAGCTGAACGGGGACGAGGAGTACAGACTGTCGGAAGGATCGCATCAGTCGTCGGCCGACTCGCGCACC
AATACCACGTCGCGGCGGTCGTCTCCGAGCAACGCCGACGGCTATGGCTACGCGGGCGTCGCGGCCACGCCGAGG
GTGGGCAACGGCACACTGCAGAATTCTTCGCAGGCTGCCATGAAAATCAAGGTGCGCTTCAACGGCGAAGTATTT
GCTATGAGGGTGCCGAAAGATGTCCAGTTTCAAGACTTGCACGACAAGATTCGAGATCGAGTCAAGGCTGTCCCT
GGCGAGCAGATCCAGCTATTCTACCACGACGATATGTCGGGGGTGCTGCAGATTTTGCAGAGCGATCTTCACCTC
GTCCATGCTCTTCAACGACAAGAGAAACTAACGCTCCTCGTCAAGGTTCACTAA
Transcript >Ophcf2|03093
ATGAAGGCACTTCGCCGGTCTATAAAGGGCGAAAAGCACAAGCAAACCCCTTCCATAGGCTCCAAATCCGCCGTC
GCCATCGTCCCGCCGAAAAAGGTTATACGAGCCACCGACGACTATATCCCCGATGAGTCTCTGATGCAGACCTTT
GCCAAGGCCGGCGTCCAGGTTCTAAGCTTCTCCAAAGGCGACTTCTTCCACGTCATCGGTCGCGAGGATGATCCG
CACTGGTACGAAGCCTGCAATCCCGCCCTCCCCGACGCCCGCGGCCTCGTGCCCGTCACCTACTTTCAGGTCCTG
GGCCGCACCGAACGCGACAGCGCCGACGGCAGCAGGCATCCCCCCATGGCCAAGAACCCGGATCACGACTCGGGT
TACGGCGAGACGGCGATACAGCAAACTGCCGCACCCCCTCAACACAGCTACAACAAATCCACCAGGACGGCGGGT
ACGGTTTACGCCAAGGTTCGCCACCCCTTCACCGCCCATCCGACCCGCCCGGACGAACTTTCGGCGGAAAAGGAC
GAGAACCTCATCATCATCGCCCAATCCAACCACGAATGGGTCGTTGCGAAACCCATAATGCGACTGGGAGGCCCC
GGCCTGATCCCGATAGACTTCATCTACGTCTTCGACGAAGCTGGCGTGCCGAGCGTCGAAGAATGGAAGCGCATG
GCTGCCCAGTACAAGAACAGCAGCATCACGCTCGGAAAGTTTGATGGTGGCAGGTCTCCTGGTGCTCAACAGCCC
TCCCTCGAGCAGGGCATGGGTCGCCTGAGTCTGCAGCCGGACACGCGGCAGAGTAGCGGAAACGGGTCTCATCAC
GCTGGCGAGTATCGGAGTGCGGGCCCGTCGCCCGTTTCTCAGGAAGCCTACGATGCCCAATCGGCTCCTCATCTG
TCGGCGCCCATATCCGCGCCCATCTGGGCGAGGATACCGCGGTACTGTTTCGCCGAGCAAAAGTACTGGTTCGTC
ATCGAGACGGAGCTCGAAAACGGTCGGTGCTACGAGCTGTCGAGGTACTACCAAGACTTTTACGACTTTCAGATT
GCCCTCCTAGCCGAGTTCCCCGTCGAGGCCGGCAACACGGGCACGCAGAAGCGGACGTTGCCCTACATGCCAGGG
CCGGTCAGTTACGTCACGGATGCCATCACCGAGGGCCGGCTTTACAACCTGGACGCCTACGTCAAGAATCTGCTG
AACCAACCGCCGCATATCTCTCGCTGCGATCTGGTCAAGCTCTTCTTCGCCCCTCGAGAGGGTGACTACGAGATC
GATTCCCAGCTGAACGGGGACGAGGAGTACAGACTGTCGGAAGGATCGCATCAGTCGTCGGCCGACTCGCGCACC
AATACCACGTCGCGGCGGTCGTCTCCGAGCAACGCCGACGGCTATGGCTACGCGGGCGTCGCGGCCACGCCGAGG
GTGGGCAACGGCACACTGCAGAATTCTTCGCAGGCTGCCATGAAAATCAAGGTGCGCTTCAACGGCGAAGTATTT
GCTATGAGGGTGCCGAAAGATGTCCAGTTTCAAGACTTGCACGACAAGATTCGAGATCGAGTCAAGGCTGTCCCT
GGCGAGCAGATCCAGCTATTCTACCACGACGATATGTCGGGGGTGCTGCAGATTTTGCAGAGCGATCTTCACCTC
GTCCATGCTCTTCAACGACAAGAGAAACTAACGCTCCTCGTCAAGGTTCACTAA
Gene >Ophcf2|03093
ATGAAGGTTCGTCGCTGCCTCGTCGCTTTTGGCCCCCCCTTCCTTCTTGCATCAGCCATCACCCGTCCGCCTACC
TGCATCATCCTCTCCTCTCCTCTCCTCTCCCCTCCCCTCCCTCCCCTCCCCATTCATCCGTCCTCCCCTCTCGCT
TCTGTCTGTCTTATCCCCTTCTGTTTCTGTTTTTTTTTCCCCCTTGATTCACCACGCCCAACGTGACTGATGGCG
GCACCCTCTCATGACCCCTCACCCTCTTTCCCCTGTCCTCCATCGCCGAAACAGACTTCCGCTTCGAGTCTCGCG
CCTTGATATCGGTACAGAGAGCTAACGTCATGGACTTGATCAAGGCACTTCGCCGGTCTATAAAGGGCGAAAAGC
ACAAGCAAACCCCTTCCATAGGCTCCAAATCCGCCGTCGCCATCGTCCCGCCGAAAAAGGTTCGTCTTCGTCCTG
CTCCGCCCCATCCCAACCGCCCAGTCGCGCTCGACGATTACTGTCGCATTGCCCATTCGTCGACCCGCCGCGACG
CCGCGACTCGAGCCGCTGGCGGCTGGGCCCTGCGCGATACCTCTGCTGACGCGCACCCACCCCGACAGGTTATAC
GAGCCACCGACGACTATATCCCCGATGAGTCTCTGATGCAGACCTTTGCCAAGGCCGGCGTCCAGGTTCTAAGCT
TCTCCAAAGGCGACTTCTTCCACGTCATCGGTCGCGAGGATGATCCGCACTGGTACGAAGCCTGCAATCCCGCCC
TCCCCGACGCCCGCGGCCTCGTGCCCGTCACCTACTTTCAGGTCCTGGGCCGCACCGAACGCGACAGCGCCGACG
GCAGCAGGCATCCCCCCATGGCCAAGAACCCGGATCACGACTCGGGTTACGGCGAGACGGCGATACAGCAAACTG
CCGCACCCCCTCAACACAGCTACAACAAATCCACCAGGACGGCGGGTACGGTTTACGCCAAGGTTCGCCACCCCT
TCACCGCCCATCCGACCCGCCCGGACGAACTTTCGGCGGAAAAGGACGAGAACCTCATCATCATCGCCCAATCCA
ACCACGAATGGGTCGTTGCGAAACCCATAATGCGACTGGGAGGCCCCGGCCTGATCCCGATAGACTTCATCTACG
TCTTCGACGAAGTCCCGCTGGGCTCCGACTCTTCTACCTCCCCCCCCCCGTTGCCGATCCTCTCGAAGCTCTGAG
AAAGGCTGGCGTGCCGAGCGTCGAAGAATGGAAGCGCATGGCTGCCCAGTACAAGAACAGCAGCATCACGCTCGG
AAAGTTTGATGGTGGCAGGTCTCCTGGTGCTCAACAGCCCTCCCTCGAGCAGGGCATGGGTCGCCTGAGTCTGCA
GCCGGACACGCGGCAGAGTAGCGGAAACGGGTCTCATGTGAGTCGCTGGCGAGGTGCTCCCTCGGCCGAACCTTG
GAGACTGACGTATCGGTTGCCCCAGCACGCTGGCGAGTATCGGAGTGCGGGCCCGTCGCCCGTTTCTCAGGAAGC
CTACGATGCCCAATCGGCTCCTCATCTGTCGGCGCCCATATCCGCGCCCATCTGGGCGAGGATACCGCGGTACTG
TTTCGCCGAGCAAAAGTACTGGTTCGTCATCGAGACGGAGCTCGAAAACGGTCGGTGCTACGAGCTGTCGAGGTA
CTACCAAGACTTTTACGACTTTCAGATTGCCCTCCTAGCCGAGTTCCCCGTCGAGGCCGGCAACACGGGCACGCA
GAAGCGGACGTTGCCCTACATGCCAGGGCCGGTCAGTTACGTCACGGATGCCATCACCGAGGGCCGGCTTTACAA
CCTGGACGCCTACGTCAAGAATCTGCTGAACCAACCGCCGCATATCTCTCGCTGCGATCTGGTCAAGCTCTTCTT
CGCCCCTCGAGAGGGTGACTACGAGATCGATTCCCAGCTGAACGGGGACGAGGAGTACAGACTGTCGGAAGGATC
GCATCAGTCGTCGGCCGACTCGCGCACCAATACCACGTCGCGGCGGTCGTCTCCGAGCAACGCCGACGGCTATGG
CTACGCGGGCGTCGCGGCCACGCCGAGGGTGGGCAACGGCACACTGCAGAGTTGGTCTCCGGCGGCAGACTCGTT
TGGCCACCGGCGAGCTGACTTTGTGACAGATTCTTCGCAGGCTGCCATGAAAATCAAGGTGCGCTTCAACGGCGA
AGTATTTGCTATGAGGGTGCCGAAAGATGTCCAGTTTCAAGACTTGCACGACAAGATTCGAGATCGAGTCAAGGC
TGTCCCTGGCGAGCAGATCCAGCTATTCTACCACGACGATATGTCGGGGGTGCTGCAGATTTTGCAGAGCGATCT
TCACCTCGTCCATGCTCTTCAACGACAAGAGAAACTAACGCTCCTCGTCAAGGTTCACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail