Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03091
Gene name
Locationscaffold_03:627459..629428
Strand-
Gene length (bp)1969
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04157 EAP30 EAP30/Vps36 family 2.3E-42 359 595
PF11605 Vps36_ESCRT-II Vacuolar protein sorting protein 36 Vps36 3.8E-23 9 91
PF16988 Vps36-NZF-N Vacuolar protein sorting 36 NZF-N zinc-finger domain 2.8E-22 137 194

GO

GO Term Description Terminal node
GO:0032266 phosphatidylinositol-3-phosphate binding Yes
GO:0043130 ubiquitin binding Yes
GO:0005543 phospholipid binding No
GO:0035091 phosphatidylinositol binding No
GO:1901981 phosphatidylinositol phosphate binding No
GO:0032182 ubiquitin-like protein binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0005515 protein binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6307 0.548 0.0484 0.0578 0.0294 0.0155 0.104 0.4209 0.3404 0.0308

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1641
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|63
Ophiocordyceps australis map64 (Brazil) OphauB2|5930
Ophiocordyceps camponoti-floridani Ophcf2|03091 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2037
Ophiocordyceps kimflemingae Ophio5|1543
Ophiocordyceps subramaniannii Hirsu2|1328

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03091
MFLKHIDLTTALRPSYLPDEVLLFVQDNVGLYEGKLKLPDHQNGQVYLTSHRICYVDKAEPRANSVALELKHVDR
FDLYAGFLKSSAKITLIPKPLKRSTLDPRAKLDAVSSSRAGSASPGLRDGAFRPPPGPPPLTTATWVCTICSFSN
PTPVNFDPSAANAYTPLPPCLACGIKPTLSHVLKAAISNASNRTLPAPIPSLGSSPARNSPLAQQVAGTDPCTPM
AASSSRTDAGTDFKCPRCTFSNHPSLLSCEMCGASLLSQPLVEQNSSARTQSPGPVREHRGPSTSSGIDASEGIK
ISFRSGGDKIFHERLKGAMTQRKWLLQNAPPCPGGSRRADEANADDSSDGASGGKLKTAGIAGLEQLGLNMRKNT
ELLIGSAFEDLEALMSSAKEVVALAERLARQNSGASAEENAILAESASQLGLVTTKDMVGGGGGSESLYLSELSR
NVAEFLTDDSRGVLKKAGGIMTLVDLWAMFNRARGGVELVSPLDFEKAARLWEKLRLPVRLRTFRSGVMVVQAHD
RTDETTIRALVAWLQDLHEFPPERETAWDWREFGRGVTAQEVAERFGWSMGVAEEELLMAEEHGALCRDEGLEGL
KFWQNYIDTGEGVPPRSRASQDEETIINALRESGLY*
Coding >Ophcf2|03091
ATGTTTCTAAAACACATCGACTTGACCACAGCGCTCCGGCCCTCGTATCTCCCCGATGAGGTGCTGTTGTTTGTG
CAGGACAATGTCGGCCTCTACGAAGGAAAGCTCAAGCTTCCAGACCACCAAAACGGTCAGGTCTACCTGACATCC
CATCGGATATGCTATGTCGACAAGGCCGAACCGCGCGCCAACTCGGTGGCTCTCGAGTTGAAACACGTCGACAGG
TTCGACTTGTATGCCGGTTTTCTCAAGAGCTCTGCCAAGATCACGCTCATTCCCAAGCCCCTGAAGCGCTCCACG
CTTGACCCCCGAGCCAAGCTTGACGCCGTGTCATCGTCGAGGGCCGGTTCTGCGTCCCCCGGTCTCCGAGACGGC
GCATTTAGGCCTCCACCCGGGCCTCCGCCGCTCACGACGGCTACATGGGTCTGCACAATATGCAGCTTCTCGAAT
CCCACACCCGTCAACTTTGATCCGTCTGCCGCCAACGCCTACACGCCTCTCCCTCCGTGTCTAGCCTGCGGCATC
AAGCCAACGCTTTCGCATGTGTTGAAGGCGGCCATCTCCAATGCCAGCAACCGGACTCTGCCCGCACCCATCCCC
AGTCTTGGGAGCAGTCCGGCTCGAAATTCGCCCTTGGCCCAACAAGTAGCCGGAACCGACCCTTGTACGCCAATG
GCAGCATCCTCATCCAGGACTGACGCCGGGACGGACTTCAAGTGTCCGCGATGCACCTTTTCCAACCACCCCTCG
TTACTGTCGTGCGAGATGTGCGGTGCTTCACTGCTGTCTCAGCCTCTGGTGGAGCAGAATTCGTCCGCGAGGACG
CAGTCGCCCGGCCCAGTCCGGGAGCACCGGGGCCCATCTACATCGAGCGGCATCGACGCCTCGGAGGGTATCAAA
ATCTCGTTTCGCAGCGGCGGAGACAAGATATTTCACGAGAGGCTCAAGGGCGCCATGACGCAAAGAAAATGGCTT
CTGCAGAACGCCCCCCCGTGCCCAGGGGGCAGCCGCCGGGCCGACGAAGCCAACGCCGATGACTCGTCCGACGGC
GCATCCGGCGGCAAGCTCAAGACGGCCGGCATCGCGGGCTTAGAGCAGCTCGGGCTGAACATGCGCAAGAACACG
GAGCTGCTGATAGGCAGCGCCTTTGAGGACCTCGAGGCCCTCATGTCATCTGCAAAGGAGGTCGTCGCCCTGGCA
GAGCGGCTAGCCCGCCAGAACAGCGGCGCGTCGGCGGAAGAGAACGCGATCCTGGCTGAGTCGGCAAGCCAGCTG
GGGCTGGTAACCACCAAGGACATGGTCGGCGGCGGCGGCGGATCCGAATCGCTTTACCTATCGGAGCTGTCTCGC
AACGTGGCCGAGTTCCTGACGGACGACTCGAGAGGCGTACTCAAGAAGGCCGGCGGCATAATGACCCTCGTCGAC
CTCTGGGCCATGTTCAACCGCGCCAGAGGCGGCGTCGAGCTCGTCAGTCCCCTAGACTTTGAAAAAGCAGCTCGC
CTCTGGGAGAAGCTCAGGCTTCCAGTCCGTCTGCGCACCTTTCGCAGCGGCGTCATGGTGGTACAGGCTCACGAC
CGCACCGACGAGACGACGATCCGCGCCCTCGTCGCCTGGCTGCAGGACCTGCACGAGTTCCCGCCCGAGCGCGAG
ACGGCCTGGGACTGGCGTGAGTTTGGCCGCGGAGTCACCGCCCAGGAGGTGGCTGAGCGCTTTGGCTGGAGCATG
GGCGTCGCCGAGGAGGAGCTTCTCATGGCGGAGGAGCACGGGGCGCTGTGTCGCGACGAGGGGCTCGAGGGCCTC
AAGTTTTGGCAGAATTACATTGATACCGGCGAGGGTGTGCCGCCCAGGAGTCGGGCCAGTCAGGACGAGGAGACT
ATCATCAACGCGCTCAGGGAGAGCGGCCTGTATTAG
Transcript >Ophcf2|03091
ATGTTTCTAAAACACATCGACTTGACCACAGCGCTCCGGCCCTCGTATCTCCCCGATGAGGTGCTGTTGTTTGTG
CAGGACAATGTCGGCCTCTACGAAGGAAAGCTCAAGCTTCCAGACCACCAAAACGGTCAGGTCTACCTGACATCC
CATCGGATATGCTATGTCGACAAGGCCGAACCGCGCGCCAACTCGGTGGCTCTCGAGTTGAAACACGTCGACAGG
TTCGACTTGTATGCCGGTTTTCTCAAGAGCTCTGCCAAGATCACGCTCATTCCCAAGCCCCTGAAGCGCTCCACG
CTTGACCCCCGAGCCAAGCTTGACGCCGTGTCATCGTCGAGGGCCGGTTCTGCGTCCCCCGGTCTCCGAGACGGC
GCATTTAGGCCTCCACCCGGGCCTCCGCCGCTCACGACGGCTACATGGGTCTGCACAATATGCAGCTTCTCGAAT
CCCACACCCGTCAACTTTGATCCGTCTGCCGCCAACGCCTACACGCCTCTCCCTCCGTGTCTAGCCTGCGGCATC
AAGCCAACGCTTTCGCATGTGTTGAAGGCGGCCATCTCCAATGCCAGCAACCGGACTCTGCCCGCACCCATCCCC
AGTCTTGGGAGCAGTCCGGCTCGAAATTCGCCCTTGGCCCAACAAGTAGCCGGAACCGACCCTTGTACGCCAATG
GCAGCATCCTCATCCAGGACTGACGCCGGGACGGACTTCAAGTGTCCGCGATGCACCTTTTCCAACCACCCCTCG
TTACTGTCGTGCGAGATGTGCGGTGCTTCACTGCTGTCTCAGCCTCTGGTGGAGCAGAATTCGTCCGCGAGGACG
CAGTCGCCCGGCCCAGTCCGGGAGCACCGGGGCCCATCTACATCGAGCGGCATCGACGCCTCGGAGGGTATCAAA
ATCTCGTTTCGCAGCGGCGGAGACAAGATATTTCACGAGAGGCTCAAGGGCGCCATGACGCAAAGAAAATGGCTT
CTGCAGAACGCCCCCCCGTGCCCAGGGGGCAGCCGCCGGGCCGACGAAGCCAACGCCGATGACTCGTCCGACGGC
GCATCCGGCGGCAAGCTCAAGACGGCCGGCATCGCGGGCTTAGAGCAGCTCGGGCTGAACATGCGCAAGAACACG
GAGCTGCTGATAGGCAGCGCCTTTGAGGACCTCGAGGCCCTCATGTCATCTGCAAAGGAGGTCGTCGCCCTGGCA
GAGCGGCTAGCCCGCCAGAACAGCGGCGCGTCGGCGGAAGAGAACGCGATCCTGGCTGAGTCGGCAAGCCAGCTG
GGGCTGGTAACCACCAAGGACATGGTCGGCGGCGGCGGCGGATCCGAATCGCTTTACCTATCGGAGCTGTCTCGC
AACGTGGCCGAGTTCCTGACGGACGACTCGAGAGGCGTACTCAAGAAGGCCGGCGGCATAATGACCCTCGTCGAC
CTCTGGGCCATGTTCAACCGCGCCAGAGGCGGCGTCGAGCTCGTCAGTCCCCTAGACTTTGAAAAAGCAGCTCGC
CTCTGGGAGAAGCTCAGGCTTCCAGTCCGTCTGCGCACCTTTCGCAGCGGCGTCATGGTGGTACAGGCTCACGAC
CGCACCGACGAGACGACGATCCGCGCCCTCGTCGCCTGGCTGCAGGACCTGCACGAGTTCCCGCCCGAGCGCGAG
ACGGCCTGGGACTGGCGTGAGTTTGGCCGCGGAGTCACCGCCCAGGAGGTGGCTGAGCGCTTTGGCTGGAGCATG
GGCGTCGCCGAGGAGGAGCTTCTCATGGCGGAGGAGCACGGGGCGCTGTGTCGCGACGAGGGGCTCGAGGGCCTC
AAGTTTTGGCAGAATTACATTGATACCGGCGAGGGTGTGCCGCCCAGGAGTCGGGCCAGTCAGGACGAGGAGACT
ATCATCAACGCGCTCAGGGAGAGCGGCCTGTATTAG
Gene >Ophcf2|03091
ATGTTTCTAAAACACATCGACTTGACCACAGCGCTCCGGCCCTCGTATCTCCCCGATGAGGTGCTGTTGTTTGTG
CAGGACAATGTCGGCCTCTACGAAGGGTTCGCAGTAATCACTACTTGCTGATGCTTTTTCCGTCTCACTGATGTA
TCGTCACAGAAAGCTCAAGCTTCCAGACCACCAAAACGGTCAGGTCTACCTGACATCCCATCGGATATGCTATGT
CGACAAGGCCGAACCGCGCGCCAACTCGGTGGCTCTCGAGTTGAAACACGTCGACAGGTTCGACTTGTATGCCGG
TTTTCTCAAGAGCTCTGCCAAGATCACGCTCATTCCCAAGCCCCTGAAGCGCTCCACGCTTGACCCCCGAGCCAA
GCTTGACGCCGTGTCATCGTCGAGGGCCGGTTCTGCGTCCCCCGGTCTCCGAGACGGCGCATTTAGGCCTCCACC
CGGGCCTCCGCCGCTCACGACGGCTACATGGGTCTGCACAATATGCAGCTTCTCGAATCCCACACCCGTCAACTT
TGATCCGTCTGCCGCCAACGCCTACACGCCTCTCCCTCCGTGTCTAGCCTGCGGCATCAAGCCAACGCTTTCGCA
TGTGTTGAAGGCGGCCATCTCCAATGCCAGCAACCGGACTCTGCCCGCACCCATCCCCAGTCTTGGGAGCAGTCC
GGCTCGAAATTCGCCCTTGGCCCAACAAGTAGCCGGAACCGACCCTTGTACGCCAATGGCAGCATCCTCATCCAG
GACTGACGCCGGGACGGACTTCAAGTGTCCGCGATGCACCTTTTCCAACCACCCCTCGTTACTGTCGTGCGAGAT
GTGCGGTGCTTCACTGCTGTCTCAGCCTCTGGTGGAGCAGAATTCGTCCGCGAGGACGCAGTCGCCCGGCCCAGT
CCGGGAGCACCGGGGCCCATCTACATCGAGCGGCATCGACGCCTCGGAGGGTATCAAAATCTCGTTTCGCAGCGG
CGGAGACAAGATATTTCACGAGAGGCTCAAGGGCGCCATGACGCAAAGAAAATGGCTTCTGCAGAACGCCCCCCC
GTGCCCAGGGGGCAGCCGCCGGGCCGACGAAGCCAACGCCGATGACTCGTCCGACGGCGCATCCGGCGGCAAGCT
CAAGACGGCCGGCATCGCGGGCTTAGAGCAGCTCGGGCTGAACATGCGCAAGAACACGGAGCTGCTGATAGGCAG
CGCCTTTGAGGACCTCGAGGCCCTCATGTCATCTGCAAAGGAGGTCGTCGCCCTGGCAGAGCGGCTAGCCCGCCA
GAACAGCGGCGCGTCGGCGGAAGAGAACGCGATCCTGGCTGAGTCGGCAAGCCAGCTGGGGCTGGTAACCACCAA
GGACATGGTCGGCGGCGGCGGCGGATCCGAATCGCTTTACCTATCGGAGCTGTCTCGCAACGTGGCCGAGTTCCT
GACGGACGACTCGAGAGGCGTACTCAAGAAGGCCGGCGGCATAATGACCCTCGTCGACCTCTGGGCCATGTTCAA
CCGCGCCAGAGGCGGCGTCGAGCTCGTCAGTCCCCTAGACTTTGAAAAAGCAGCTCGCCTCTGGGAGAAGCTCAG
GCTTCCAGTCCGTCTGCGCACCTTTCGCAGCGGCGTCATGGTGGTACAGGCTCACGACCGCACCGACGAGACGAC
GATCCGCGCCCTCGTCGCCTGGCTGCAGGACCTGCACGAGTTCCCGCCCGAGCGCGAGACGGCCTGGGACTGGCG
TGAGTTTGGCCGCGGAGTCACCGCCCAGGAGGTGGCTGAGCGCTTTGGCTGGAGCATGGGCGTCGCCGAGGAGGA
GCTTCTCATGGCGGAGGAGCACGGGGCGCTGTGTCGCGACGAGGGGCTCGAGGGCCTCAAGTTTTGGCAGAATTA
CATTGATACCGGCGAGGGTGTGCCGCCCAGGAGTCGGGCCAGTCAGGACGAGGAGACTATCATCAACGCGCTCAG
GGAGAGCGGCCTGTATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail