Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03089
Gene name
Locationscaffold_03:625248..625577
Strand+
Gene length (bp)329
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11022 ATP19 ATP synthase subunit K 4.9E-28 5 69

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1456.78 816.48 2097.07
Alive In ants, during behavior modification 1009.53 519.68 1499.39
Dead In ants, recently dead 740.27 375.16 1105.37

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.066897 no
Alive Dead 0.089318 no
Dead Fungus 0.000454 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03089
MGGLSYYTIAGRQVGSHYIAMAWLGTLFGGVWYATSGPKKTAVAATPPIQASSSDEADFIKRFMEEQEKQEKK*
Coding >Ophcf2|03089
ATGGGTGGCCTCTCCTACTATACGATTGCCGGCCGCCAAGTCGGCAGTCATTATATTGCCATGGCCTGGCTAGGC
ACACTCTTCGGCGGCGTCTGGTATGCTACATCGGGCCCGAAGAAGACGGCGGTAGCGGCGACACCTCCAATTCAG
GCATCGAGCTCGGACGAGGCCGACTTCATCAAGAGGTTTATGGAAGAACAAGAGAAGCAAGAAAAAAAGTAA
Transcript >Ophcf2|03089
ATGGGTGGCCTCTCCTACTATACGATTGCCGGCCGCCAAGTCGGCAGTCATTATATTGCCATGGCCTGGCTAGGC
ACACTCTTCGGCGGCGTCTGGTATGCTACATCGGGCCCGAAGAAGACGGCGGTAGCGGCGACACCTCCAATTCAG
GCATCGAGCTCGGACGAGGCCGACTTCATCAAGAGGTTTATGGAAGAACAAGAGAAGCAAGAAAAAAAGTAA
Gene >Ophcf2|03089
ATGGGTGGCCTCTCCTACTATACGATTGCCGGCCGCCAAGTCGGCAGTCATTATGTTCGTGCGGTCAAGCCCGGA
GGTGCACAGAGACGATGACTGACCTGGCGTTGCAGATTGCCATGGCCTGGCTAGGCACACTCTTCGGCGGCGTCT
GGTATGCTACATCGGGCCCGAAGAAGACGGCGGTAGCGGCGACACCTCCAATTCAGGCATCGAGCTCGGACGAGG
CCGACTTCATCAAGTGCGTGACCTGACTGGACGGCTGAGGCTTGGCTAACGGACTGAACTACAGGAGGTTTATGG
AAGAACAAGAGAAGCAAGAAAAAAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail