Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03083
Gene name
Locationscaffold_03:610803..611692
Strand+
Gene length (bp)889
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11566 PI31_Prot_N PI31 proteasome regulator N-terminal 7.8E-11 6 112

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.594 0.6664 0.1285 0.0817 0.3028 0.0218 0.1155 0.1104 0.0247 0.0155

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6059
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|50
Ophiocordyceps australis map64 (Brazil) OphauB2|5913
Ophiocordyceps camponoti-floridani Ophcf2|03083 (this protein)
Ophiocordyceps kimflemingae Ophio5|4113
Ophiocordyceps subramaniannii Hirsu2|2225

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03083
MPPSGPQAWPSGGALTFFYADAKLTVRVDGLGPLLHVRIFAEGARRVVTLERRVADLVRGEGLPVRVPEEEHDKS
AYLIAKLRAVFVSEKAMTDFANDLTRTMTDEIFPNRQTPSTLLQETQPQPDPYEIPTTKQKQQQRQRQQRQTPSP
QRITPRQTTSRPQASTTSSTSPAPVLQGYPTPSSLSHRPRRPQPPGLGPRDPLRPFMDPRPDHHSGMIPSFDDFL
RPHIDPEEVDTQPPPGARWDPLGPGGAPRFPPPGSGRFPGPGGNFFGGGGGII*
Coding >Ophcf2|03083
ATGCCGCCATCCGGACCGCAAGCCTGGCCCTCCGGCGGCGCCCTCACCTTCTTCTACGCAGACGCCAAACTCACC
GTCCGCGTCGATGGGCTCGGCCCGCTGCTTCACGTTCGCATCTTTGCTGAGGGGGCCCGTCGTGTCGTCACTTTG
GAGAGGAGGGTTGCTGATCTTGTGAGGGGTGAGGGGCTGCCTGTTCGTGTGCCGGAGGAGGAGCATGATAAGAGC
GCCTACTTGATTGCAAAGCTTCGAGCTGTCTTTGTCTCGGAAAAGGCCATGACCGACTTCGCCAACGACCTCACC
CGAACTATGACCGACGAAATCTTCCCCAACCGTCAAACCCCCTCCACCCTCCTCCAAGAAACCCAACCTCAACCC
GACCCCTACGAGATACCCACCACGAAACAAAAACAACAACAACGACAACGACAACAACGACAAACCCCCTCGCCA
CAGCGAATAACCCCCCGACAGACGACTTCCCGCCCCCAGGCTTCGACGACGAGCTCGACCTCGCCCGCCCCCGTC
CTCCAAGGATACCCAACGCCTTCGTCCCTTTCCCATCGGCCACGACGACCTCAACCCCCGGGTCTCGGCCCCAGG
GATCCCCTCCGCCCCTTCATGGATCCCCGTCCCGACCACCATTCCGGCATGATACCGTCCTTTGATGACTTCCTC
CGGCCTCACATCGACCCCGAAGAAGTGGACACTCAGCCTCCGCCCGGCGCTCGTTGGGATCCCCTCGGTCCCGGC
GGTGCTCCTCGCTTCCCGCCTCCGGGCAGTGGCCGGTTTCCCGGGCCTGGGGGTAACTTCTTTGGCGGTGGCGGA
GGCATCATCTAG
Transcript >Ophcf2|03083
ATGCCGCCATCCGGACCGCAAGCCTGGCCCTCCGGCGGCGCCCTCACCTTCTTCTACGCAGACGCCAAACTCACC
GTCCGCGTCGATGGGCTCGGCCCGCTGCTTCACGTTCGCATCTTTGCTGAGGGGGCCCGTCGTGTCGTCACTTTG
GAGAGGAGGGTTGCTGATCTTGTGAGGGGTGAGGGGCTGCCTGTTCGTGTGCCGGAGGAGGAGCATGATAAGAGC
GCCTACTTGATTGCAAAGCTTCGAGCTGTCTTTGTCTCGGAAAAGGCCATGACCGACTTCGCCAACGACCTCACC
CGAACTATGACCGACGAAATCTTCCCCAACCGTCAAACCCCCTCCACCCTCCTCCAAGAAACCCAACCTCAACCC
GACCCCTACGAGATACCCACCACGAAACAAAAACAACAACAACGACAACGACAACAACGACAAACCCCCTCGCCA
CAGCGAATAACCCCCCGACAGACGACTTCCCGCCCCCAGGCTTCGACGACGAGCTCGACCTCGCCCGCCCCCGTC
CTCCAAGGATACCCAACGCCTTCGTCCCTTTCCCATCGGCCACGACGACCTCAACCCCCGGGTCTCGGCCCCAGG
GATCCCCTCCGCCCCTTCATGGATCCCCGTCCCGACCACCATTCCGGCATGATACCGTCCTTTGATGACTTCCTC
CGGCCTCACATCGACCCCGAAGAAGTGGACACTCAGCCTCCGCCCGGCGCTCGTTGGGATCCCCTCGGTCCCGGC
GGTGCTCCTCGCTTCCCGCCTCCGGGCAGTGGCCGGTTTCCCGGGCCTGGGGGTAACTTCTTTGGCGGTGGCGGA
GGCATCATCTAG
Gene >Ophcf2|03083
ATGCCGCCATCCGGACCGCAAGCCTGGCCCTCCGGCGGCGCCCTCACCTTCTTCTACGCAGACGCCAAACTCACC
GTCCGCGTCGATGGGCTCGGCCCGCTGCTTCACGTTCGCATCTTTGCTGAGGGGGCCCGTCGTGTCGTCACTTTG
GAGAGGAGGGTTGCTGATCTTGTGAGGGGTGAGGGGCTGCCTGTTCGTGTGCCGGAGGAGGAGCATGATAAGAGC
GCCTACTTGATTGCAAAGCTTCGAGCTGTCTTTGTCTCGGAAAAGGCCATGACCGGTACGAATATCCCATCTTCA
CCCTCCCCATCTCCCTCTAACCACTCCTCCAGACTTCGCCAACGACCTCACCCGAACTATGACCGACGAAATCTT
CCCCAACCGTCAAACCCCCTCCACCCTCCTCCAAGAAACCCAACCTCAACCCGACCCCTACGAGATACCCACCAC
GAAACAAAAACAACAACAACGACAACGACAACAACGACAAACCCCCTCGCCACAGCGAATAACCCCCCGACAGAC
GACTTCCCGCCCCCAGGCTTCGACGACGAGCTCGACCTCGCCCGCCCCCGTCCTCCAAGGATACCCAACGCCTTC
GTCCCTTTCCCATCGGCCACGACGACCTCAACCCCCGGGTCTCGGCCCCAGGGATCCCCTCCGCCCCTTCATGGA
TCCCCGTCCCGACCACCATTCCGGCATGATACCGTCCTTTGATGACTTCCTCCGGCCTCACATCGACCCCGAAGA
AGTGGACACTCAGCCTCCGCCCGGCGCTCGTTGGGATCCCCTCGGTCCCGGCGGTGCTCCTCGCTTCCCGCCTCC
GGGCAGTGGCCGGTTTCCCGGGCCTGGGGGTAACTTCTTTGGCGGTGGCGGAGGCATCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail