Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03076
Gene name
Locationscaffold_03:591164..592598
Strand+
Gene length (bp)1434
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 9.1E-15 146 224
PF08544 GHMP_kinases_C GHMP kinases C terminal 2.1E-09 315 372

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7126 0.483 0.0129 0.0881 0.3451 0.0317 0.1534 0.087 0.1187 0.4386

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1033
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2772
Ophiocordyceps australis map64 (Brazil) OphauB2|1924
Ophiocordyceps camponoti-floridani Ophcf2|03076 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4205
Ophiocordyceps kimflemingae Ophio5|2416
Ophiocordyceps kimflemingae Ophio5|4629
Ophiocordyceps subramaniannii Hirsu2|9468

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03076
MAGPNTSLPAFMVSAPGKVIVFGEHSVVYDKSAIAAAISLRSYLHVAPSSSRIVTLRLTDINLVHEWPVDDLPWP
AFKQEGKKQSFDARLSVLDPDLVAALQPHVARVSMTDCPDEARKVHRSAALAFLYLLLSLHDASSLSGCRYTLRS
TIPIGAGLGSSASVSVCLATAFLLQRSALVPPHSDQTVAEALAQVERINNWAFVGEMCIHGKPSGVDNTVVSQGR
AVLYRRGHGVRPLWTFPQLPLLLIDTRQAKSTAQEVAKVVALKEKHPDVVASLLEAMDQVTGSADILLASRAMQA
PESVKSATDRETGHLGELMRINHGLLVSLGVSHPRIERVRELVDHNGLGWTKLTGSGGGGCCIALKQPGVSEDDL
SALRRRLLDENYQLLETTLGGEGVGLLCNGARESDIDVDDFVAAEDTDGIEVVINRGKARGEGWKFWGIEGDMEA
*
Coding >Ophcf2|03076
ATGGCGGGTCCAAACACCTCTCTCCCGGCCTTCATGGTCTCGGCCCCGGGAAAGGTCATCGTCTTCGGCGAGCAT
TCCGTCGTCTATGACAAGTCTGCCATCGCCGCCGCAATCTCACTGCGTTCCTATCTTCACGTCGCGCCGTCGTCG
AGTCGGATCGTGACGCTGAGGCTGACGGATATCAACCTCGTACACGAGTGGCCCGTCGACGACCTCCCCTGGCCA
GCCTTCAAGCAAGAGGGCAAGAAGCAATCATTCGACGCTCGCCTTTCAGTACTGGATCCAGATCTCGTCGCCGCG
CTGCAGCCGCATGTCGCCCGCGTCTCGATGACGGATTGTCCCGACGAGGCGCGTAAAGTTCATCGAAGCGCCGCC
TTGGCCTTTCTCTATCTTCTACTATCACTCCACGATGCCTCCTCGCTATCTGGCTGCCGTTATACGCTGCGATCG
ACCATCCCCATTGGCGCCGGCCTCGGCAGCAGCGCCTCCGTCTCCGTCTGCCTCGCCACGGCCTTTCTCCTGCAG
CGGAGCGCCCTCGTCCCTCCCCACTCGGATCAGACCGTCGCCGAGGCTCTCGCCCAGGTGGAGCGTATCAACAAT
TGGGCCTTTGTCGGCGAGATGTGCATCCACGGGAAACCGTCGGGCGTTGACAATACCGTCGTCTCTCAGGGCAGA
GCCGTGCTGTACCGGCGCGGCCACGGCGTGCGTCCGCTGTGGACCTTTCCTCAGCTGCCACTGCTTCTCATAGAT
ACCAGGCAAGCAAAGTCTACGGCGCAAGAGGTGGCTAAAGTGGTTGCTCTTAAGGAGAAGCATCCTGACGTTGTC
GCGTCCCTGCTCGAGGCCATGGACCAGGTAACGGGAAGCGCCGACATTCTCTTGGCATCGCGCGCCATGCAGGCA
CCAGAATCGGTCAAATCGGCGACGGACCGGGAGACGGGCCATCTGGGCGAGCTCATGCGCATCAACCACGGCCTT
CTCGTCTCGCTCGGCGTTTCGCACCCGCGCATCGAGAGGGTCCGCGAGCTCGTCGACCACAACGGCCTCGGCTGG
ACTAAGCTGACGGGCTCCGGCGGTGGCGGCTGCTGCATCGCCCTCAAGCAGCCCGGTGTGTCCGAAGACGACTTG
TCTGCGCTCCGACGCCGACTGCTCGACGAGAATTACCAGCTACTGGAGACGACGCTCGGAGGCGAGGGCGTGGGT
TTGCTTTGCAACGGGGCCCGTGAGTCGGACATTGATGTCGATGACTTCGTCGCTGCTGAGGACACGGACGGCATC
GAGGTGGTTATCAACAGGGGCAAAGCAAGGGGCGAGGGATGGAAGTTTTGGGGCATCGAGGGCGACATGGAGGCT
TAG
Transcript >Ophcf2|03076
ATGGCGGGTCCAAACACCTCTCTCCCGGCCTTCATGGTCTCGGCCCCGGGAAAGGTCATCGTCTTCGGCGAGCAT
TCCGTCGTCTATGACAAGTCTGCCATCGCCGCCGCAATCTCACTGCGTTCCTATCTTCACGTCGCGCCGTCGTCG
AGTCGGATCGTGACGCTGAGGCTGACGGATATCAACCTCGTACACGAGTGGCCCGTCGACGACCTCCCCTGGCCA
GCCTTCAAGCAAGAGGGCAAGAAGCAATCATTCGACGCTCGCCTTTCAGTACTGGATCCAGATCTCGTCGCCGCG
CTGCAGCCGCATGTCGCCCGCGTCTCGATGACGGATTGTCCCGACGAGGCGCGTAAAGTTCATCGAAGCGCCGCC
TTGGCCTTTCTCTATCTTCTACTATCACTCCACGATGCCTCCTCGCTATCTGGCTGCCGTTATACGCTGCGATCG
ACCATCCCCATTGGCGCCGGCCTCGGCAGCAGCGCCTCCGTCTCCGTCTGCCTCGCCACGGCCTTTCTCCTGCAG
CGGAGCGCCCTCGTCCCTCCCCACTCGGATCAGACCGTCGCCGAGGCTCTCGCCCAGGTGGAGCGTATCAACAAT
TGGGCCTTTGTCGGCGAGATGTGCATCCACGGGAAACCGTCGGGCGTTGACAATACCGTCGTCTCTCAGGGCAGA
GCCGTGCTGTACCGGCGCGGCCACGGCGTGCGTCCGCTGTGGACCTTTCCTCAGCTGCCACTGCTTCTCATAGAT
ACCAGGCAAGCAAAGTCTACGGCGCAAGAGGTGGCTAAAGTGGTTGCTCTTAAGGAGAAGCATCCTGACGTTGTC
GCGTCCCTGCTCGAGGCCATGGACCAGGTAACGGGAAGCGCCGACATTCTCTTGGCATCGCGCGCCATGCAGGCA
CCAGAATCGGTCAAATCGGCGACGGACCGGGAGACGGGCCATCTGGGCGAGCTCATGCGCATCAACCACGGCCTT
CTCGTCTCGCTCGGCGTTTCGCACCCGCGCATCGAGAGGGTCCGCGAGCTCGTCGACCACAACGGCCTCGGCTGG
ACTAAGCTGACGGGCTCCGGCGGTGGCGGCTGCTGCATCGCCCTCAAGCAGCCCGGTGTGTCCGAAGACGACTTG
TCTGCGCTCCGACGCCGACTGCTCGACGAGAATTACCAGCTACTGGAGACGACGCTCGGAGGCGAGGGCGTGGGT
TTGCTTTGCAACGGGGCCCGTGAGTCGGACATTGATGTCGATGACTTCGTCGCTGCTGAGGACACGGACGGCATC
GAGGTGGTTATCAACAGGGGCAAAGCAAGGGGCGAGGGATGGAAGTTTTGGGGCATCGAGGGCGACATGGAGGCT
TAG
Gene >Ophcf2|03076
ATGGCGGGTCCAAACACCTCTCTCCCGGCCTTCATGGTCTCGGCCCCGGGAAAGGTCATCGTCTTCGGCGAGCAT
TCCGTCGTCTATGACAAGGTAAAATATAAGGGGGACGAATCGCGACTCGAGTCGGCTCAGAGAATGCCTTTGGTC
GTCCGCCGCTGAGACCGTGAAAAGTCTGCCATCGCCGCCGCAATCTCACTGCGTTCCTATCTTCACGTCGCGCCG
TCGTCGAGTCGGATCGTGACGCTGAGGCTGACGGATATCAACCTCGTACACGAGTGGCCCGTCGACGACCTCCCC
TGGCCAGCCTTCAAGCAAGAGGGCAAGAAGCAATCATTCGACGCTCGCCTTTCAGTACTGGATCCAGATCTCGTC
GCCGCGCTGCAGCCGCATGTCGCCCGCGTCTCGATGACGGATTGTCCCGACGAGGCGCGTAAAGTTCATCGAAGC
GCCGCCTTGGCCTTTCTCTATCTTCTACTATCACTCCACGATGCCTCCTCGCTATCTGGCTGCCGTTATACGCTG
CGATCGACCATCCCCATTGGCGCCGGCCTCGGCAGCAGCGCCTCCGTCTCCGTCTGCCTCGCCACGGCCTTTCTC
CTGCAGCGGAGCGCCCTCGTCCCTCCCCACTCGGATCAGACCGTCGCCGAGGCTCTCGCCCAGGTGGAGCGTATC
AACAATTGGGCCTTTGTCGGCGAGATGTGCATCCACGGGAAACCGTCGGGCGTTGACAATACCGTCGTCTCTCAG
GGCAGAGCCGTGCTGTACCGGCGCGGCCACGGCGTGCGTCCGCTGTGGACCTTTCCTCAGCTGCCACTGCTTCTC
ATAGATACCAGGCAAGCAAAGTCTACGGCGCAAGAGGTGGCTAAAGTGGTTGCTCTTAAGGAGAAGCATCCTGAC
GTTGTCGCGTCCCTGCTCGAGGCCATGGACCAGGTAACGGGAAGCGCCGACATTCTCTTGGCATCGCGCGCCATG
CAGGCACCAGAATCGGTCAAATCGGCGACGGACCGGGAGACGGGCCATCTGGGCGAGCTCATGCGCATCAACCAC
GGCCTTCTCGTCTCGCTCGGCGTTTCGCACCCGCGCATCGAGAGGGTCCGCGAGCTCGTCGACCACAACGGCCTC
GGCTGGACTAAGCTGACGGGCTCCGGCGGTGGCGGCTGCTGCATCGCCCTCAAGCAGCCCGGTGTGTCCGAAGAC
GACTTGTCTGCGCTCCGACGCCGACTGCTCGACGAGAATTACCAGCTACTGGAGACGACGCTCGGAGGCGAGGGC
GTGGGTTTGCTTTGCAACGGGGCCCGTGAGTCGGACATTGATGTCGATGACTTCGTCGCTGCTGAGGACACGGAC
GGCATCGAGGTGGTTATCAACAGGGGCAAAGCAAGGGGCGAGGGATGGAAGTTTTGGGGCATCGAGGGCGACATG
GAGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail